KEGG   Mycobacterium intracellulare 1956: LG41_17890Help
Entry
LG41_17890        CDS       T03407                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mie  Mycobacterium intracellulare 1956
Pathway
mie00071  Fatty acid degradation
mie00072  Synthesis and degradation of ketone bodies
mie00280  Valine, leucine and isoleucine degradation
mie00310  Lysine degradation
mie00362  Benzoate degradation
mie00380  Tryptophan metabolism
mie00620  Pyruvate metabolism
mie00630  Glyoxylate and dicarboxylate metabolism
mie00640  Propanoate metabolism
mie00650  Butanoate metabolism
mie00900  Terpenoid backbone biosynthesis
mie01100  Metabolic pathways
mie01110  Biosynthesis of secondary metabolites
mie01120  Microbial metabolism in diverse environments
mie01130  Biosynthesis of antibiotics
mie01200  Carbon metabolism
mie01212  Fatty acid metabolism
mie02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mie00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LG41_17890
   00630 Glyoxylate and dicarboxylate metabolism
    LG41_17890
   00640 Propanoate metabolism
    LG41_17890
   00650 Butanoate metabolism
    LG41_17890
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LG41_17890
   00072 Synthesis and degradation of ketone bodies
    LG41_17890
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LG41_17890
   00310 Lysine degradation
    LG41_17890
   00380 Tryptophan metabolism
    LG41_17890
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LG41_17890
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LG41_17890
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LG41_17890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mie04147]
    LG41_17890
Enzymes [BR:mie01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LG41_17890
Exosome [BR:mie04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LG41_17890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIT86717
Position
3829472..3830620
Genome map
AA seq 382 aa AA seqDB search
MHPQALLARCLTALAERTDFDPVDVDDVIAGNGILSGDHGDDIARMSVLLAGWPETVPGM
TLSRFCGSGQQAVTVAAAGIAAGSEDLVIAGGVESMSRWGVTAGVPTIDGNNPDLRAVYP
TVPQGISADLIATLEGFGREVVDAYAAQSQSRAAVAIEERRFDRSLVDVAAPAGRVEHDE
HPRPGTTTETLSRLTPAFEAMGAVRADGEQRTFDEICLERYPGVDRIDHVHHAGNSSGVV
DGAAAVLLASSNWMHTHRVTPRAQIRATAAIGSEPIIMLTAPGPAAQRCLERAGMTVADI
DLWEINEAFAAVPLKTMRDLDIDPDVVNVNGGAIALGHPIGATGAMLIGTVLDELERRDL
TTGLVTMCTGGGMGTATIIERV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgcacccgcaggccttgctcgcgcgctgcctcaccgcactggccgagcggaccgacttc
gatccggtcgacgtcgatgacgtgatcgccggcaacggcatcctcagcggggaccacggc
gacgacatcgcccgaatgtccgttctgttggcggggtggccagagaccgtgccggggatg
acgttgagccggttctgcggctcgggccagcaggccgtcaccgttgcggcggcgggcatc
gccgccggcagtgaggatttggtgatcgccggcggtgtcgagtcgatgtcgcggtggggg
gtaacggccggggtcccgacgatcgacggcaacaatcccgatcttcgcgcagtgtacccg
actgtgccacaaggcatttcggccgacctgatcgcgaccctggagggattcggccgcgag
gtcgtcgacgcctacgccgcgcagagccagagccgcgccgccgtggccatcgaggagcgg
cgcttcgatcgttccctggtcgacgtggccgcacccgccggccgcgtggaacacgacgag
catccgcgcccgggcaccaccactgagacgctgtcacgcctcacaccggccttcgaggcg
atgggggccgtgcgcgccgacggcgagcaacgcacgttcgacgagatttgcctcgagcgc
tatcccggcgtcgaccgcatcgatcacgtgcaccacgcgggcaactcgtccggcgtggtc
gacggcgccgccgccgtgctgctcgcctcctccaactggatgcacacccaccgcgtgacc
ccgcgggcgcagatccgggcgaccgcggccatcggcagcgaaccgatcatcatgctcacc
gcgcccggccccgcggcgcagcggtgcctggaacgcgccggcatgacggtggccgacatc
gatctgtgggagatcaacgaggccttcgccgcggtcccgctcaagacgatgcgcgatctg
gacatcgatcccgacgtggtcaacgtcaacggcggcgcgatcgccctcgggcacccgatc
ggcgccaccggcgccatgctgatcggcaccgttctcgacgaactcgaacgtcgcgacctg
acaacgggactggtgaccatgtgcacgggcggcgggatgggcacggcgacgatcatcgag
cgggtgtga

DBGET integrated database retrieval system