KEGG   Methanocaldococcus infernus: Metin_0452Help
Entry
Metin_0452        CDS       T01234                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
mif  Methanocaldococcus infernus
Brite
Enzymes [BR:mif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Metin_0452
Transfer RNA biogenesis [BR:mif03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Metin_0452
Chromosome and associated proteins [BR:mif03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Metin_0452
   HAT complexes
    Elongator complex
     Metin_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 SMC_Nse1 DUF4359
Motif
Other DBs
NCBI-ProteinID: ADG13122
UniProt: D5VRB9
Position
complement(409041..410645)
Genome map
AA seq 534 aa AA seqDB search
MKEKLMRCIIERILKEYKEGKTLDKKRIEQIKSECLRIYRIGIGHPSNSEILKYATEEEK
KILIPILRKKPVRTISGVAVVAVMTSPAKCPHGKCIFCPGGLDSVFGDVPQSYTGREPAT
MRGLMFNFDPYLQTRARIEQLEKVGHPTDKIELIIMGGTFPAREIEYQDWFIKRCLDAMN
ERESKSLEEAQKINETAKHRCVALCIETRPDYCSEKEINQMLKLGATRVELGVQSIYNEI
LKLCKRGHSVEDTIKATQLLKDSGLKVSYHLMPGMPGSSIEMDKKMFKEIFTNPDFMPDM
VKIYPCLVIEGTELYEMWKRGEFKPYREEEAIEVISYAKSIMPKWVRTSRIQRDIPATVI
VDGVKKSNLGELVYKYMEKKGLRCRCIRCREVGHVYYKKGILPDPEHIKLVREDYEASGG
TEIFLSFEDVKNDILIAFLRLRDPYKPFRKEIDDKTMLVRQLHVFGWEKALTRDIKEVSW
QHMGYGRMLMKEAERIAKEEFGKKKILVTSGIGVREYYRKLGYKRVGAYMGKEL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaagctaatgagatgtatcatagagagaattttaaaagaatacaaagaggga
aaaaccttagacaaaaaaaggatagagcaaattaaaagtgagtgtttaagaatttacaga
attggaatagggcatccatcaaactctgaaattttaaagtatgcaactgaagaggagaag
aaaattttaattccaattttaagaaagaagcctgttagaaccatctcaggggttgctgtt
gttgcagttatgacatccccagctaagtgtccacatggtaaatgtatcttttgccctgga
ggtttagatagtgtctttggagatgttcctcagagttatactggaagagagcctgcaaca
atgaggggcttgatgtttaactttgacccttacttacaaacaagggcaaggatagagcag
ttggaaaaggttgggcatccaactgataaaattgagctcatcatcatgggaggaaccttt
ccagcaagggaaatagagtatcaggattggtttataaagagatgcttagatgcaatgaat
gaaagggaaagtaaaagcttagaagaggctcagaagattaatgagacggctaagcataga
tgtgtagccctctgtatagagacaaggccagactactgtagtgagaaagagataaaccag
atgcttaagttgggagctacaagagttgagttaggggttcagtcaatttataatgaaata
ttaaagctatgtaagagagggcatagtgttgaagacactataaaggctacacaactctta
aaagatagtgggttaaaggtttcttatcatctaatgccagggatgccaggatcaagtata
gagatggacaagaagatgtttaaggaaatctttacgaaccctgactttatgccagacatg
gttaaaatctatccttgcttagttatagaggggacagagctttatgagatgtggaagagg
ggagagtttaaaccttacagagaagaggaggctatagaagttatcagctatgctaaatct
atcatgcctaagtgggttagaacttcaaggattcagagggatattcctgcaactgttata
gttgatggagttaagaagagtaacttaggagagcttgtttataagtatatggagaaaaaa
gggttaaggtgtagatgtataagatgtagagaggtaggacatgtttattacaaaaaaggc
atcttaccagatcctgagcatataaagttggttagggaagattatgaggcaagtggagga
actgaaattttcttatcctttgaagatgttaaaaatgacatattaatagcctttttaagg
ttgagagatccatataaaccatttaggaaagagattgatgataaaactatgttagttaga
cagctacatgtttttggatgggaaaaggctttaacaagagatataaaagaggttagctgg
caacatatgggatatggaaggatgttgatgaaagaagctgagagaatagctaaggaagag
tttgggaaaaagaagatattggtcacaagtggaataggggttagggaatattacagaaag
ttggggtataaaagagttggagcttatatggggaaagagctttaa

DBGET integrated database retrieval system