KEGG   Methanocaldococcus infernus: Metin_1337Help
Entry
Metin_1337        CDS       T01234                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mif  Methanocaldococcus infernus
Pathway
mif00010  Glycolysis / Gluconeogenesis
mif00020  Citrate cycle (TCA cycle)
mif00620  Pyruvate metabolism
mif00633  Nitrotoluene degradation
mif00640  Propanoate metabolism
mif00650  Butanoate metabolism
mif00680  Methane metabolism
mif00720  Carbon fixation pathways in prokaryotes
mif01100  Metabolic pathways
mif01120  Microbial metabolism in diverse environments
mif01130  Biosynthesis of antibiotics
mif01200  Carbon metabolism
Module
mif_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mif_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_1337
   00020 Citrate cycle (TCA cycle)
    Metin_1337
   00620 Pyruvate metabolism
    Metin_1337
   00640 Propanoate metabolism
    Metin_1337
   00650 Butanoate metabolism
    Metin_1337
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metin_1337
   00680 Methane metabolism
    Metin_1337
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metin_1337
Enzymes [BR:mif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metin_1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR DUF1177
Motif
Other DBs
NCBI-ProteinID: ADG13987
UniProt: D5VTT4
Position
1200506..1201042
Genome map
AA seq 178 aa AA seqDB search
MIEIRFHGRGGQGAVTAAQILAKAAFYDGKYCQAFPFFGVERRGAPVRAFTRIDDKEILI
RSQIYEPDYVVVLDPTLLDSVNVLEGLKKDGAVIVNTVKDLDLGYKVYTLDATKIALDVL
GVPIVNTSMVGAFAGATKLVSLESVKKAILETFKGKLGEKNALAAEKAYNEIIEKYGE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaaattagattccatgggagaggagggcaaggggctgttactgcagcccaaatt
ttggctaaagctgccttttatgatggaaagtattgccaggcatttcctttttttggtgtt
gagaggagaggtgcaccagttagagctttcacaagaattgatgataaagaaattttgata
agatctcaaatctatgagcctgattatgttgttgtcttagatccaactcttttagattct
gtaaatgtcttagaggggttaaagaaggatggagctgtaattgttaacactgttaaagac
ttagatttaggatataaagtttatacacttgacgcaacaaagatagccttagatgtttta
ggagttcctattgttaatacatcaatggttggagcctttgctggagcaactaagttggtt
agcttagaatctgtaaagaaagctattttagagacatttaaagggaagttgggagagaag
aatgccttagctgctgagaaggcatacaatgagatcatagagaagtatggtgagtaa

DBGET integrated database retrieval system