KEGG   Methanotorris igneus: Metig_0068Help
Entry
Metig_0068        CDS       T01510                                 

Definition
(GenBank) deoxyribose-phosphate aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K16305  fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mig  Methanotorris igneus
Pathway
mig00010  Glycolysis / Gluconeogenesis
mig00030  Pentose phosphate pathway
mig00051  Fructose and mannose metabolism
mig00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mig00680  Methane metabolism
mig01100  Metabolic pathways
mig01110  Biosynthesis of secondary metabolites
mig01120  Microbial metabolism in diverse environments
mig01130  Biosynthesis of antibiotics
mig01200  Carbon metabolism
mig01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metig_0068
   00030 Pentose phosphate pathway
    Metig_0068
   00051 Fructose and mannose metabolism
    Metig_0068
  Energy metabolism
   00680 Methane metabolism
    Metig_0068
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metig_0068
Enzymes [BR:mig01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Metig_0068
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Metig_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: AEF95629
UniProt: F6BEG8
Position
complement(77170..78075)
Genome map
AA seq 301 aa AA seqDB search
MGKKDVIVPLDVPESARKKYIENYLELTKNTGRVMLFAGDQKMEHLNDDFYGEGIAKDDA
DPEHLFRIASKAKIGAFATQLGLIARYGMDYRKVPYIVKINSKTHLVKTSQRDPISRALI
DVKDVVEFQNNSGLNILGVGYTIYPGSEYEHIMFAEASRIVYEAHKHGLIAIIWSYPRGK
AVKNEKDPHLIAGAAGVAACLGADFVKVNYPECKNAAEAFKEAVLAAGRTKVLCAGGPSV
DVKAFLQRLYEQIHVSGAAGNATGRNIHQKPLDEAIRMCNAIYAITVENKTVEEALKIYE
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaaagatgttatagtgccacttgatgttccagaatctgcaagaaaaaaatac
atagaaaattatttagagctcacaaaaaatactggtagagtaatgttgtttgctggagat
caaaaaatggaacatttaaatgatgacttctatggggaggggatagcaaaagatgatgct
gacccagaacacctttttagaattgccagtaaggcaaaaattggagcatttgctactcag
ttgggattaatagcgagatacggtatggattatagaaaggtgccatatattgttaaaata
aattcaaaaacccatttggttaaaacatcccaaagagatccaataagtagggctttgatt
gatgtaaaggatgtcgtcgagtttcaaaacaattcagggcttaatatattaggagtgggt
tatacaatctatcccggtagtgaatatgagcacatcatgttcgctgaggcttcaagaatc
gtatatgaagctcacaaacacggcttaatagcaattatttggtcttacccaagaggcaag
gcagttaaaaatgaaaaagatcctcatttaatagcaggggctgcaggagttgcagcatgt
ttaggagcagattttgttaaagtaaattatccagaatgtaaaaatgcagcagaagcgttt
aaagaggcggtattagcagcaggaagaacaaaagtgctatgtgctggaggaccaagtgta
gatgttaaggcatttttgcagaggttatatgagcaaatacacgttagtggcgctgcagga
aatgcaacaggaagaaatattcatcaaaaacctcttgatgaagcaataaggatgtgcaat
gctatttatgcaattaccgttgaaaataaaaccgttgaagaggcactaaaaatttacgaa
ggataa

DBGET integrated database retrieval system