KEGG   Methanotorris igneus: Metig_0072Help
Entry
Metig_0072        CDS       T01510                                 

Definition
(GenBank) Cellulase
Organism
mig  Methanotorris igneus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AEF95633
UniProt: F6BEH2
Position
complement(82784..83836)
Genome map
AA seq 350 aa AA seqDB search
MRVVEYLKKLAEEKGISGREHRVRELMKKELEPMVDEIYVDKFGNLIARKGDKGPKIMLA
AHMDEIGLMVKYIDEKGFLKFTKIGGINDQMILNQKVIVHGNKGDIIGVLGSKPPHKMKE
SERNKLIKYEDMFIDIGAESREEAIEMGVEIGTWVTFKSEFNELGKNRFTCKAFDDRVGC
AVLLEVMRRIKDEDLNCQVYAVGTVQEEVGLKGARTSAFGINPDVALALDVTICGDHPGI
KMEDAPVELGKGPVVGIVDAAGRGLITHPKVLDMIRDISKKYDIPVQYEVGEGGTTDATA
IHLTRDGIPTGVISIPARYIHTPVEVIDKRDVEKTVELVVSCIKDLDKYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagggtagttgaatatttaaaaaagcttgcagaggaaaaaggaatttctggaagagaa
catagagtcagagagttaatgaaaaaagagcttgagccaatggttgatgaaatctacgtg
gacaaatttgggaatttaattgcgagaaagggagataaagggccaaagataatgcttgct
gcacacatggatgagattgggttaatggttaaatacattgatgaaaaaggattcttgaag
ttcacaaaaattgggggcataaatgaccagatgatcctaaaccaaaaggtcattgttcat
ggaaataagggagatattattggggttttaggttcaaaaccaccacacaaaatgaaagaa
agcgagagaaacaaacttattaaatatgaggatatgtttattgacattggggcagagagt
agggaagaggcaattgaaatgggtgttgagataggaacatgggttacattcaagtcagaa
ttcaatgagttagggaaaaacagatttacatgcaaagcatttgatgatagggtaggatgt
gcagttttattggaagttatgaggagaattaaagatgaggacttgaactgccaagtttat
gcagtaggaacagtccaggaagaagttggtttaaaaggggcaaggacatctgcctttgga
ataaatccagatgttgctttggcgttggatgttaccatctgtggagaccatccgggaata
aagatggaagatgcaccagttgaattaggaaaagggcctgttgtggggatagttgatgca
gcagggagaggattgatcactcatccaaaggtattggacatgataagagatatctccaaa
aaatatgatattccagttcaatatgaagtcggtgaaggtggaacaacagacgctacagca
atccatttaacaagggatggtatcccaactggagtaatttctatcccagcaagatacatc
cacacaccagttgaagttatcgataagagagatgtggaaaaaactgttgaattagttgtt
tcatgcataaaagatttagacaaatacttctaa

DBGET integrated database retrieval system