KEGG   Methanotorris igneus: Metig_0121Help
Entry
Metig_0121        CDS       T01510                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mig  Methanotorris igneus
Pathway
mig00260  Glycine, serine and threonine metabolism
mig00750  Vitamin B6 metabolism
mig01100  Metabolic pathways
mig01110  Biosynthesis of secondary metabolites
mig01120  Microbial metabolism in diverse environments
mig01230  Biosynthesis of amino acids
Module
mig_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metig_0121
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metig_0121
Enzymes [BR:mig01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metig_0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEF95682
UniProt: F6BEU6
Position
122292..123509
Genome map
AA seq 405 aa AA seqDB search
MIQKCIRCGKEYDFDEIIYTCECGGLLEIVYDYEAIKEKVSKETLRKREIGVWRYLEYMP
VKDPKKIVTLHEGGTPLYKCDNLAKELGLKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVKVVGCASTGNTSASLAAYSARSGKKCIVLLPEGKVALGKLAQAMFYGAKVIQIKGNFD
DALEMVRELAEKKLLYLLNSVNPFRLEGQKTIGFEICDQLNWEVPDRVILPVGNAGNISA
IWKGFKEFRETGIIDELPKMTGIQAEGAKPIVDAVKKGAKEIIPEEHPETIATAIRIGNP
VNAPKALDAIYSSGGTAESVTDEEIIHAQKLLARTEGIFVEPASASSIAGLIKLLDMGVI
DRDERIVCITTGHGLKDPDAAIRASEKPIEIECDIKVLEKLLMEL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaatgtattagatgtggaaaagagtacgatttcgatgagataatttacacc
tgcgaatgtggtggtttgttagagattgtttatgattatgaggcaataaaggaaaaggta
tcaaaagaaacattaagaaagagagaaattggagtttggagatacttggaatatatgcct
gtaaaagacccaaaaaagatcgtcacccttcatgaaggagggactcctttatacaaatgt
gacaaccttgcaaaagagttgggattgaaagaattatatgtaaaaaatgaaggagcaaat
ccaactggaagttttaaggatagaggaatgactgttggtgtaacaagggctaatgaactt
ggagttaaagttgtaggatgtgcatcaactggaaacacatctgcttcattggcagcatat
tcagcaagaagtggtaaaaaatgtattgttctattgccagaagggaaagtagcattggga
aaacttgctcaagcaatgttctatggagcaaaggttattcaaattaaagggaactttgat
gatgctttggagatggtcagagaacttgcagagaagaaacttctatatttgctcaattca
gttaacccatttagattagaagggcaaaaaactattggatttgagatttgcgaccagtta
aactgggaggttccagatagggtaattttaccagtagggaatgcaggaaatatctccgct
atatggaaaggatttaaggagtttagagaaacaggaattattgatgaactcccaaaaatg
actggaattcaggcagagggtgcaaagccaatagttgacgcagttaaaaagggagcaaaa
gaaattattccagaggaacatccagagacaatagcaacagcaataaggattggaaatcca
gtaaatgcaccaaaggcattggatgcaatatactcatcaggaggaacagcagaatctgtc
acagatgaggaaataatacacgctcaaaaattattagcaagaacagaggggatttttgtt
gagccagcgtctgcctcatcaatcgctggtttgataaaattgttagacatgggtgttatt
gatagggatgagagaattgtctgtataacaacaggacatggattaaaagacccagatgcg
gcaataagggcaagtgaaaaaccaattgaaattgaatgtgacataaaagttttagaaaaa
ttgttgatggaattgtaa

DBGET integrated database retrieval system