KEGG   Methanotorris igneus: Metig_0363Help
Entry
Metig_0363        CDS       T01510                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mig  Methanotorris igneus
Pathway
mig00010  Glycolysis / Gluconeogenesis
mig00051  Fructose and mannose metabolism
mig00562  Inositol phosphate metabolism
mig01100  Metabolic pathways
mig01110  Biosynthesis of secondary metabolites
mig01120  Microbial metabolism in diverse environments
mig01130  Biosynthesis of antibiotics
mig01200  Carbon metabolism
mig01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metig_0363
   00051 Fructose and mannose metabolism
    Metig_0363
   00562 Inositol phosphate metabolism
    Metig_0363
Enzymes [BR:mig01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metig_0363
Exosome [BR:mig04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metig_0363
  Exosomal proteins of bladder cancer cells
   Metig_0363
  Exosomal proteins of melanoma cells
   Metig_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS His_biosynth NMO Glu_synthase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AEF95919
UniProt: F6BB34
Position
374564..375229
Genome map
AA seq 221 aa AA seqDB search
MKPVIIINYKTYKESIGKRGLEIAKIAEKVSEESGITIGVAPQFVDLRIVAENVNIPVYA
QHIDAITPGSHTGHVLAEAIKDCGVKGTLLNHSERNMLLSDIDKAIEIAKSLELETIVCT
NNINVSKAVAALNPTYIAIEPPELIGTGIPVSKANPEIVEGTVKEVRKINKDVKILCGAG
ISTGSDVKAALELGTDGVLLASGVVKAKDVEKAIRDLISEI
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagttataatcatcaactacaaaacatacaaagaaagtatagggaagagggga
ttagagatagcaaaaattgctgagaaggtttcagaggagagcggcataacaattggtgtt
gctcctcaatttgtagatttaagaatagttgctgagaatgtaaatattcctgtatacgct
cagcacattgatgccataacacctggaagccatacaggacatgtgttggcagaggctatt
aaggattgtggtgttaaagggactttgttaaaccattcagaaagaaatatgctcttatca
gacattgataaagccatagaaattgcaaagagtttggaacttgagaccattgtttgcacc
aacaacataaatgtatcaaaagccgttgcagcattaaatccaacttacattgccatagaa
ccaccagaattaattggaactggaattcctgtttccaaagcaaacccagagattgttgaa
ggaacagttaaagaagttagaaaaataaacaaggatgtcaaaattctttgtggagctgga
atatcaactggaagtgatgtaaaagcagcattggaacttggaacagatggagttttactt
gcatctggtgtagtcaaggcgaaagatgttgaaaaagcaataagagatttgataagtgag
atttaa

DBGET integrated database retrieval system