KEGG   Methanotorris igneus: Metig_0597Help
Entry
Metig_0597        CDS       T01510                                 

Definition
(GenBank) von Willebrand factor type A
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mig  Methanotorris igneus
Pathway
mig00860  Porphyrin and chlorophyll metabolism
mig01100  Metabolic pathways
mig01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metig_0597
Enzymes [BR:mig01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Metig_0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA VWA_CoxE
Motif
Other DBs
NCBI-ProteinID: AEF96151
UniProt: F6BCE0
Position
complement(606844..607641)
Genome map
AA seq 265 aa AA seqDB search
MRDSIYRYSSGRHIKSISKKGRYIKYRIPHGKTTDIAFDATFRVSALYQKERREKFKDKN
LALYLTKDDLREKVRERKISSHLLFVVDASGSMGAMRRMEAAKGAVLSLLMDAYQKRNKV
GMIAFRKDMAELVLPFTSSVELGEKLLKELPTGGKTPLSKAFLKAYEVFKNEMRKNPNII
PIMIFISDFKPNVAIKKDYIKEVFDICDKIAEEGINVILIDTEPKSFIKIGIGDKIAKRY
GFKYYKIDDISVDGILNIVNPLINY
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgagagatagcatatacagatatagtagtgggaggcacataaagagtattagcaaaaaa
ggaagatatataaaatatagaattccgcatggaaaaacaactgatattgcctttgatgca
acatttagggttagtgcattatatcaaaaagaaagaagagagaaatttaaggacaaaaat
ttggcattgtatcttacaaaagatgatttaagggaaaaggttagagaaagaaaaatatca
tctcatttactgtttgttgttgatgcgagtgggtctatgggtgcgatgaggagaatggaa
gctgcaaagggagcagttttgtctctcttaatggatgcatatcaaaaaagaaataaagta
ggaatgattgcgtttagaaaagatatggcagaacttgttttgcctttcacttcatctgtt
gaacttggagagaaattactcaaagaactcccaactggtggaaaaacacccctttcaaaa
gcatttttaaaggcatatgaggtttttaaaaatgaaatgaggaaaaatccgaacataata
ccaattatgatattcattagtgattttaagccaaatgtagctattaaaaaagattatata
aaagaggtctttgatatctgtgataaaattgcagaagaaggaataaacgtcatattaata
gatacagaaccaaaatcattcataaaaataggtattggtgataaaatcgctaagagatat
gggtttaagtattataaaatagatgatattagcgtagatggaattttgaacatcgttaac
cctttaataaattattaa

DBGET integrated database retrieval system