KEGG   Methanotorris igneus: Metig_1538Help
Entry
Metig_1538        CDS       T01510                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mig  Methanotorris igneus
Pathway
mig00260  Glycine, serine and threonine metabolism
mig00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mig01100  Metabolic pathways
mig01110  Biosynthesis of secondary metabolites
mig01130  Biosynthesis of antibiotics
mig01230  Biosynthesis of amino acids
Module
mig_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metig_1538
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metig_1538
Enzymes [BR:mig01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metig_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: AEF97072
UniProt: F6BAY5
Position
1577772..1578626
Genome map
AA seq 284 aa AA seqDB search
MSRLAEKFEELKNKNEKALVAFYVGGDPNLEISKEALEVIANIADIVEIGIPFSDPVADG
PTIQKADVRALNKGMNPLKAFELVKELDEKAPNTPKVFLTYYNIIFNMGEEEFVKRCKEC
GIDGLVVPDLPIEEAESLYNICKKYGVDLIFLVAPTTPDERLKRILEKCSGFVYVVSVTG
ITGVREKVQEETKELVKRVARYSNVPICVGFGISKREHVEEITQYADGAIVGSAIVRIVE
KYLDENGEIKDKEAFLRELEEFVKELKEGTKQKILVKNKVKTKK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagtagattagcagagaaatttgaggagttaaaaaataaaaatgaaaaggcattagtc
gcattttacgttggaggagatccaaatttggagatttcaaaagaagcacttgaagttatt
gcaaatatagcggatattgttgaaattggtattccattttcagatccagttgctgatggt
ccaacaattcaaaaggcagatgtaagggcgttaaataaaggaatgaatccattaaaggca
tttgaacttgttaaagagttggatgagaaagctccaaacactccaaaggtgttcttaacc
tattataatataatatttaacatgggagaagaggagtttgtgaaaagatgtaaggaatgt
gggattgatgggttagttgttcctgatttgccaattgaggaggcagaaagtttatacaac
atctgcaaaaaatatggtgttgatttgatatttttggttgctccaacaactccagacgag
aggctaaagagaatcttggaaaaatgtagtgggtttgtttatgttgtttcagtaactgga
attactggagttagggagaaagtccaagaagagacaaaggaactcgtcaaaagagtggca
agatactcaaatgttccaatatgcgttggatttgggatttcaaagagggaacacgttgag
gagataacacaatatgcggatggagcaattgttggtagtgcaatagtaaggattgttgag
aagtatttggatgaaaatggagaaattaaagataaagaggcatttttgagggagttagag
gaatttgttaaagaattaaaagaggggacaaaacaaaaaattttggtgaagaacaaagta
aaaacaaaaaaatga

DBGET integrated database retrieval system