KEGG   Methanotorris igneus: Metig_1634Help
Entry
Metig_1634        CDS       T01510                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mig  Methanotorris igneus
Pathway
mig00860  Porphyrin and chlorophyll metabolism
mig01100  Metabolic pathways
mig01110  Biosynthesis of secondary metabolites
mig01120  Microbial metabolism in diverse environments
Module
mig_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metig_1634
Enzymes [BR:mig01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Metig_1634
Exosome [BR:mig04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Metig_1634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AEF97167
UniProt: F6BBG0
Position
1670869..1671843
Genome map
AA seq 324 aa AA seqDB search
MLIRPRRLRKNQKIRDLVRETTLTKNDLIMPIFVDENLKSNERKEIQSMPNQYRFSIEGA
VEEAKEIADLGIPAVILFGIPKHKDEVASSAYDKNGVIQKTIKGIKDELGDELLVIADVC
LCEYTSHGHCGIVKDGKILNDETLEILSKIALSYAESGADIVAPSDMMDGRVKAIRETLE
KHGFDDVAIMSYAAKYASSFYGPFRDAAESAPKFGDRKSYQMDIGNAREAMKEIKLDIEE
GADLILVKPALPYLDIIRMARDRFDVPIGGYCVSGEYAMVEAAARNGWLNRESAIFETLL
SIKRAGADFIITYWAKEVASWYLY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcagaccaaggagattgagaaaaaaccaaaaaattagagatttggttagagaa
acaacattaacaaaaaatgatttaataatgccaatatttgtggatgaaaatttgaaaagc
aatgaaaggaaggaaatacaatcaatgcctaaccaatatagattcagcatagagggagct
gttgaagaagcaaaagaaattgctgatttaggtattccagcagttattttgtttggaatc
ccaaaacacaaagatgaagtagcatcatctgcttatgataaaaacggagttatccaaaaa
actataaagggtattaaagatgagttgggggatgaacttttggttattgcagatgtttgc
ttatgcgaatacacatcccacggacattgtggaatcgttaaggatggaaagatattaaat
gacgaaaccttggagattttaagtaaaatagcactttcctatgcagaaagtggggctgat
attgtagctccgtcagatatgatggatgggagggttaaagcaattagggaaaccttagaa
aaacatggatttgatgacgttgctataatgagttatgcggcaaaatatgcatcctctttc
tacggcccatttagggatgcagcagagagtgccccaaaatttggggatagaaaaagttat
caaatggatattggaaatgcaagagaggcgatgaaagagattaagttggacattgaagaa
ggggcggatttaatacttgtaaaaccagcattaccttacttggacataataaggatggca
agggacagatttgatgtgcctattggaggatattgtgttagtggagagtatgcaatggtt
gaagcagcagcaaggaatggatggttgaatagagaaagtgcaatatttgaaacattattg
agtataaaaagggcaggggcagatttcataataacatactgggcaaaggaagtggcatca
tggtatttatattaa

DBGET integrated database retrieval system