KEGG   Methanotorris igneus: Metig_1650Help
Entry
Metig_1650        CDS       T01510                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mig  Methanotorris igneus
Pathway
mig00020  Citrate cycle (TCA cycle)
mig00640  Propanoate metabolism
mig00660  C5-Branched dibasic acid metabolism
mig00720  Carbon fixation pathways in prokaryotes
mig01100  Metabolic pathways
mig01110  Biosynthesis of secondary metabolites
mig01120  Microbial metabolism in diverse environments
mig01130  Biosynthesis of antibiotics
mig01200  Carbon metabolism
Module
mig_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metig_1650
   00640 Propanoate metabolism
    Metig_1650
   00660 C5-Branched dibasic acid metabolism
    Metig_1650
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metig_1650
Enzymes [BR:mig01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metig_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 DUF5461 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEF97182
UniProt: F6BBH5
Position
1690553..1691656
Genome map
AA seq 367 aa AA seqDB search
MKLHEYEAKNIFKEYGIPIPEGFIISKEEISKIDDIGINKPVVVKAQVLVGGRGKAGGIL
FADNKEELKEKINELFSKEIKGEEVEKVLIEEKLPIKKEYYLGIVIDRTEKRPAIMFSTE
GGVDIEEVAKRNPEKIVKYHIEPRKEFLPYSARWILKHAGIPSKEIPIVADVMYKLYKVF
KEMDAVLAEINPLVITEDGKVYAADAVLNVDDDAYYRHDYSKFEEFGKKEKLEFAYVELD
GDIGVIGNGAGLTLASMDIIKEFGGNPACFLDIGGGASAEIVKKALKKVLENPKVRGVFI
NILGGITRCDEVAKGIVEILKEHPNVKFAVRMMGTNEEEGRKILEENGIPYETSMEEAAR
KLMENLA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcatgaatatgaagcaaaaaacatatttaaggaatatggaattccaattcca
gaaggttttattatttcaaaggaagaaatttcaaagatagatgacatcgggattaataag
cctgttgtagttaaagctcaggttttagttggtggaagaggaaaagcaggaggaatttta
tttgcagataataaagaggagttaaaagagaagattaatgaactttttagcaaagagata
aaaggagaggaagttgagaaggtattaattgaggagaaattgccaataaaaaaggaatac
tacttgggaattgttattgatagaactgaaaaaaggccagctattatgttttcaactgag
ggtggagtagatattgaagaagtagcaaaaagaaaccctgaaaagatcgtaaaataccac
atagaaccaagaaaagagttccttccatactctgcaaggtggattttgaaacatgcaggt
attccatcaaaagaaatccctatagttgctgatgttatgtataagttatataaagtattc
aaagaaatggatgccgtattggctgagataaaccctcttgttataacagaggatggaaag
gtttatgctgctgacgctgttttgaatgtcgatgatgatgcttattataggcatgattac
tcaaagtttgaagaatttggtaaaaaggagaaattagaatttgcctatgttgagttggat
ggggacattggggttattggaaatggagcaggtttgacgttggcaagtatggacattatt
aaagaatttggtggaaatccagcatgtttcttagatattggcggtggagcaagtgcagag
attgttaaaaaggcattgaaaaaggttttagaaaatccaaaggttaggggagtttttata
aatatacttggtggaataacaaggtgtgatgaggttgcaaagggaattgttgagatttta
aaagagcatcctaatgtaaaatttgccgttagaatgatgggaactaatgaagaagaggga
aggaaaattttagaggaaaatggcattccttacgaaacttcaatggaagaggcagcaaga
aaattaatggagaatttggcataa

DBGET integrated database retrieval system