KEGG   Microbacterium sp. BH-3-3-3: BJP65_04875Help
Entry
BJP65_04875       CDS       T04827                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mih  Microbacterium sp. BH-3-3-3
Pathway
mih00051  Fructose and mannose metabolism
mih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BJP65_04875
Enzymes [BR:mih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BJP65_04875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh
Motif
Other DBs
NCBI-ProteinID: AOX45217
Position
1046975..1048126
Genome map
AA seq 383 aa AA seqDB search
MKAVHFGAGNIGRGFVGLLLHEGGYELVFSDVSAALVAAINDASSYTVHEVGDGGVDKTV
TGFRAIDSSVDAESLVDEIATADVVTTAVGPTILKFVAPHIVAGLALRDPSLAPLQIMAC
ENAIGATDQLREHIVELAGESWDALAARAVFANTAVDRIVPAQAQGGVDVTVEPFYEWAI
ERGPFGDTPPHIPGAHFVDDLEPYIERKLFTVNTGHATTAYFGARAGIDRISDALADPAI
SARVEAALEETSALLVQKHELDPDVQGEYRATILRRFRNAALPDTVWRVGRQPLRKLSRH
ERFVGPAAEAIERGLPVDALVAAMAAALDFSDTEDTQAVDLQRLLRELDAEAFTAEVTGL
TPEHPLHARIVEIVAARQAALAA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtccacttcggcgcgggcaacatcggtcgcggcttcgtcggactgctgctg
cacgagggcggctacgagctcgtcttctccgacgtctcggcggctctggtcgcggccatc
aacgacgcctcgtcgtacaccgtccacgaggtgggagacggcggcgtcgacaagacggtc
accggtttccgtgccatcgacagctcggtggatgccgagtccctcgtcgacgagatcgcc
acggccgacgtggtcaccaccgccgtcggtcccaccatcctgaagttcgtggctccgcac
atcgtcgcggggctcgcgctgcgcgacccctcgctcgccccgttgcagatcatggcgtgc
gagaacgcgatcggcgcgaccgaccagctgcgcgagcacatcgtcgagctggccggcgag
tcgtgggacgccctggccgcccgcgcggtgttcgccaacacggcggtcgaccgcatcgtt
cccgcccaggcgcagggcggtgtcgacgtcaccgtcgagccgttctacgagtgggcgatc
gagcgcgggcccttcggcgacacccctccgcacatccccggtgcgcacttcgtcgacgac
ctcgagccctacatcgagcgcaagctcttcacggtgaacacgggccacgccacgacggcg
tacttcggcgcgcgcgccggcatcgaccgcatctccgacgcgctggcagaccctgcgatc
tcggcacgggtcgaggccgcgctggaagaaaccagcgccctgctggtccagaagcacgag
ctcgaccccgacgtgcagggcgagtaccgcgcgacgatcctgcgccgcttccgcaacgcg
gcgcttcccgacaccgtctggcgggtgggtcgccagccgctgcgcaagctctcgcggcac
gagcgcttcgtcgggcccgccgccgaggcgatcgagcggggtctcccggtcgacgcgctg
gtcgcggccatggccgccgccctcgacttctcggataccgaggacacccaggccgtcgac
ctgcagcgtctgctgcgcgagctcgacgccgaggccttcacggcagaggtgacggggctc
actcccgagcacccgctgcacgcccggatcgtcgagatcgtcgccgcacggcaggcagcc
ctggccgcgtga

DBGET integrated database retrieval system