KEGG   Microbacterium sp. BH-3-3-3: BJP65_05325Help
Entry
BJP65_05325       CDS       T04827                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
mih  Microbacterium sp. BH-3-3-3
Pathway
mih00860  Porphyrin and chlorophyll metabolism
mih01100  Metabolic pathways
mih01110  Biosynthesis of secondary metabolites
mih01120  Microbial metabolism in diverse environments
Module
mih_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mih00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BJP65_05325
Enzymes [BR:mih01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     BJP65_05325
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BJP65_05325
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     BJP65_05325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AOX45293
Position
complement(1156881..1158125)
Genome map
AA seq 414 aa AA seqDB search
MIALAGLDLTDRLVVCVGAGSVAERRIARLRAAGARVRLVAPVATERLSALAASGAIEWH
ARPFAASDLDDAWFCHTATGDAAIDAVVVDAAEERRVWCVNAGHGGRGTARLAAETTSGD
VMVGVVSTAGADPRRTVAVRDAIAQRLAEGALPLRRRRRPLVGSVALVGGGPGPIDLMTV
RARALLAEADVVVHDRLGPTGVLAELGDDVELVDVGKRPQHHPVPQDEINAIIVDRAAKG
LRVVRLKGGDPFVYGRGGEEVIACRAAGIPVEVIPGISSAIAVPAAAGVPVTHRGVAGTL
HVVNGQDAPSEATLAALRDDTATVVALMGVSALARFVSAARAAGAPDTRPVAFVENGHTP
QQRTIRTTLGTAIQDAETHRLANPAVLVFGEVARADLLLPAAVPVAAAHGEGIG
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctctcgcaggacttgacctcaccgaccgtctcgtggtgtgcgtgggggcgggg
agcgtcgcggaacggcgcatcgcccggctccgcgccgccggagcgcgggtgcggctcgtc
gccccggtcgccaccgagcggttgagcgccctcgcggcgtcgggtgcgatcgagtggcac
gcgcgccccttcgcggcctccgacctcgacgacgcctggttctgccacaccgccaccggc
gacgcggccatcgacgccgtcgtcgtcgacgccgccgaagagcgacgcgtgtggtgcgtc
aacgccgggcacgggggccggggcaccgcgcgcctggcggccgagaccaccagcggcgac
gtgatggtcggcgtggtctcgaccgccggcgccgacccgcgtcgcaccgtcgccgtccgc
gacgcgatcgcccagcgcctcgccgagggcgccctcccgctccgccgtcgacgtcgcccg
ctcgtggggagcgtggcgctcgtcggcggcggccccggccccatcgacctgatgacggtg
cgcgcccgtgcgctgctggccgaagccgacgtcgtcgtgcacgaccggctcgggcccacc
ggcgtgctcgccgagctcggcgacgacgtcgagctggtcgacgtgggcaagcgcccgcag
catcaccccgtgccgcaggacgagatcaacgcgatcatcgtcgaccgcgcggcgaagggc
ctgcgggtcgtgcggctcaagggcggcgacccgttcgtctacggtcgcggcggtgaagag
gtcatcgcgtgccgggccgccggcattccggtcgaggtcattccgggcatctccagtgcc
atcgctgttcccgcggcggcgggggtccccgtgacgcaccgcggtgtggccggtacgctt
cacgtcgtgaacggtcaggatgccccgagcgaggccaccctcgccgcgctccgtgacgac
accgcgacggtcgtcgccctcatgggtgtgagcgcgctggcgcgcttcgtgtcggcggcc
cgcgccgccggtgctcccgacacccgccccgtcgccttcgtcgagaacggccacacgccc
cagcagcgcaccatccgcacgaccctcggcaccgcgatccaggatgccgagacccaccgc
ctcgccaaccccgcggtgctcgtgttcggcgaggtcgcccgcgccgacctgctgctgccg
gcggcggtgcccgtcgccgcggcgcacggcgagggcatcgggtga

DBGET integrated database retrieval system