KEGG   Microbacterium sp. BH-3-3-3: BJP65_14860Help
Entry
BJP65_14860       CDS       T04827                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mih  Microbacterium sp. BH-3-3-3
Pathway
mih00450  Selenocompound metabolism
mih00970  Aminoacyl-tRNA biosynthesis
mih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mih00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BJP65_14860
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJP65_14860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mih01007]
    BJP65_14860
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mih03016]
    BJP65_14860
Enzymes [BR:mih01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BJP65_14860
Amino acid related enzymes [BR:mih01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BJP65_14860
Transfer RNA biogenesis [BR:mih03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BJP65_14860
 Prokaryotic type
   Other AARSs
    BJP65_14860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AOX46914
Position
3229384..3230976
Genome map
AA seq 530 aa AA seqDB search
MTSGRSFYITTPIYYPSDLPHIGHGYTTVAVDTLARWHRQAGDDTWMLTGTDEHGQKMLR
AAAANGVTPQEWVDKLVTESWFPLLETLDVANDDFIRTTQPRHEERVQQFVQALFDRGYI
YAGEYEALYCVGCEEFKPEAEIVDGTGPFEGLKVCAIHSKPLELLQEKNYFFKLSEFQDR
LLELYKTEPDFVRPESARNEVVSFVRSGLKDLSISRSAFDWGITVPWDPSHVIYVWVDAL
LNYATAVGYGTDPVTGEVAEEFARRWPAFHVVGKDILRFHAVIWPAMLMAAGLDVPRGVF
AHGWLLVGGEKMSKSKLTGIAPTEITDVFGSDAYRFYFLSAIAFGQDGSFSWEDLSARYQ
AELANGFGNLASRTIAMIEKYFAGIVPPAGEYAEGDFAIQRIVADAAASADAAVERFRID
EAIQSIWTIVDALNGYITENEPWALAKDETKRERLGTVLYTAAEGLRALAVLLSPVMPVA
TDKLWTALGAAESLGGVRDQPLREAGAWGVLRAGTSVAGLSPLFPRVEQA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgacttccggccgatccttctacatcacgacgccgatctactaccccagcgatctgccc
cacatcgggcacgggtacacgaccgtcgccgtcgacacgctcgcgcgctggcaccgccag
gcgggcgacgacacctggatgctcacgggcaccgacgagcacggccagaagatgctgcgc
gcggccgccgccaacggcgtgaccccgcaggagtgggtcgacaagctcgtcaccgagtcg
tggttcccgctgctcgagaccctcgacgtcgccaacgacgacttcatccgcacgacgcag
ccccgccacgaggagcgcgtgcagcagttcgtgcaggctctcttcgaccgcggctacatc
tacgcgggcgagtacgaggccctgtactgcgtgggctgcgaggagttcaagcccgaagcc
gagatcgtcgacgggaccgggccgttcgaggggctcaaagtctgcgcgatccactccaag
ccgctcgagctgctgcaagagaagaactacttcttcaagctcagcgagttccaggaccgc
ctgctcgagctgtacaagaccgagcccgacttcgtgcgccccgagtcggcgcgcaacgag
gtcgtgtcgttcgtgcgcagcggtctgaaagacctgtcgatctcgcgctcggccttcgac
tggggcatcacggttccgtgggacccctcgcacgtcatctacgtgtgggtcgatgcgctg
ctcaactacgccaccgccgtgggctacggcaccgacccggtcaccggagaggtcgccgag
gagttcgcccgccgctggcccgcgttccacgtcgtcggcaaagacatcctgcgcttccac
gccgtcatctggccggccatgctcatggccgccggcctcgacgtgccccgcggcgtcttc
gcgcacggctggctgctcgtcggcggcgagaagatgtcgaagtccaagctcaccggcatc
gcgcccaccgagatcaccgacgtcttcggctccgacgcgtaccgcttctacttcctctcc
gcgatcgccttcggccaggacggctccttctcgtgggaagacctgtcggcccgctatcag
gccgagctcgccaacggcttcggcaacctggcatcccgcaccatcgcgatgatcgagaag
tacttcgcggggatcgtgcccccggccggcgaatacgccgagggcgatttcgccattcag
cggatcgtggcggatgccgcggcctccgccgacgcggccgtggagcggttccgcatcgac
gaggccatccagtcgatctggacgatcgtcgacgcgctcaacggctacatcaccgagaac
gagccgtgggccctggcgaaagacgagacgaagcgcgagcgcctcggcaccgtgctgtac
accgccgcggagggactgcgcgccctcgcggtgctgttgtcgcccgtcatgcccgtcgcg
accgacaagctgtggaccgccctcggtgccgccgagagcctgggcggcgtgcgcgatcag
cccctccgcgaagcgggagcctggggcgtgctgcgggcggggacgtcggtcgccggcctg
tcgccgctgttcccgcgcgtcgagcaggcgtga

DBGET integrated database retrieval system