KEGG   Microbulbifer sp. A4B17: BTJ40_04050Help
Entry
BTJ40_04050       CDS       T05421                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00330  Arginine and proline metabolism
mii00360  Phenylalanine metabolism
mii00380  Tryptophan metabolism
mii00627  Aminobenzoate degradation
mii00643  Styrene degradation
mii01100  Metabolic pathways
mii01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BTJ40_04050
   00360 Phenylalanine metabolism
    BTJ40_04050
   00380 Tryptophan metabolism
    BTJ40_04050
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTJ40_04050
   00643 Styrene degradation
    BTJ40_04050
Enzymes [BR:mii01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BTJ40_04050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AWF80057
UniProt: A0A2S1JNT8
Position
complement(896761..898008)
Genome map
AA seq 415 aa AA seqDB search
MKGVFCEHGPRYLTLSDSGPLTGVRLAVKDIFQLKGEKNTAGSPEWFNTHPPANKTALSL
QQLLEAGSTFTGFTHLDELAYSMQGSNLHYGSADNPKLPGYFCGGSSMGSAAAVASGTAD
IGLGTDTGGSVRVPASYCGLFGIRTSHSLIPTDGVIGLAPCFDTVGWFSQTPSLLVDVGK
ILIPSQHLSTNKVTHLVICPEISQLADTPIQAAIQEFIPTLNNQFPICEIKHLPDIELLG
ELANVFRILQGRAIANTHGDWLRKYRPVFSKDIATRITMALSITDDEISWANEKRQQWCK
LMETLLPDNSSVLLVPTTPTTAIKKGTDSESSKVQTNRQRLLGLTAIAGLWGAPQCHLPL
FSIVENGINTGGKEIEKPSGFSLIMTPRSDFSLLALVEQLTKSLEGIAGSTQGAT
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
ataaaaggcgtattttgcgagcacggacctcgctatttaacgttatcagattccggaccg
ctaacaggcgtacgtttagcggtcaaagatatctttcaattgaaaggggagaaaaatacg
gcaggcagccccgagtggttcaatactcaccctcctgccaataaaaccgcacttagcttg
cagcaattactggaggccggctcaacctttactgggtttactcaccttgatgaactcgcc
tacagcatgcaggggagtaatttacattacggttctgccgacaaccctaaactgcctggc
tatttttgtgggggttcctctatgggatcggccgccgccgtggcctcaggaacagccgat
attggcttaggcaccgacaccggcggatcggtgagggtgcctgcaagctattgtggttta
ttcggcattcgaaccagtcactcacttattcctactgacggtgttatcggtttagcaccc
tgctttgatactgtcggttggtttagtcaaactccttcactacttgtagacgtcggcaaa
attctaatcccgtcacagcacttatccacaaataaagtaacccacctggttatttgcccc
gagatcagtcaactggcagatacgcccattcaagcagcaatccaggaatttattcccaca
ttaaataatcaatttcctatctgcgagattaaacacctgcctgacattgaattactgggc
gaactggctaatgtattccgaattttgcagggccgcgccatcgccaatactcacggagac
tggttgcgaaaataccggccggtattttcaaaggacatagccacaagaattactatggcc
ctatcaattaccgacgatgagatatcctgggccaacgaaaaacgacaacagtggtgcaag
ttgatggaaacgttactaccggacaacagtagcgttttactagtaccaaccacccccaca
actgcaattaagaaagggaccgatagtgaatctagcaaagtacaaacaaatcgccagcga
ctattgggtttaaccgctattgcagggctttggggcgccccccagtgtcatctgccgttg
ttttctatcgtagaaaatgggattaatactgggggaaaagagatagagaaaccctctggc
ttctcattgataatgactccacgaagcgatttttcgcttttggctctagtggagcaacta
acgaaatccctcgaaggaatagcaggtagcacccaaggtgctacctga

DBGET integrated database retrieval system