KEGG   Microbulbifer sp. A4B17: BTJ40_06000Help
Entry
BTJ40_06000       CDS       T05421                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00790  Folate biosynthesis
mii01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTJ40_06000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mii04147]
    BTJ40_06000
Enzymes [BR:mii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BTJ40_06000
Exosome [BR:mii04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTJ40_06000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a DUF2181
Motif
Other DBs
NCBI-ProteinID: AWF80396
UniProt: A0A2S1JPQ2
Position
1355351..1355695
Genome map
AA seq 114 aa AA seqDB search
MTELAQQQCEACRADAPLVSDDELPGLLRQIPDWTPMTRDGIMQLERVFKFRNFKQALAF
TNRVGAIAEEVGHHPALLTEWGKVTVTWWSHEAKGLHKNDFIMAARTDEQVDAA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactagctcaacaacaatgtgaagcctgtcgtgccgatgcaccgctggtaagt
gatgacgaactgccagggttgctgcgacagatccccgattggacacccatgacccgtgac
ggaatcatgcagctggaacgtgtgttcaagtttcgtaatttcaagcaggctctggccttt
accaaccgtgtcggtgctattgctgaagaggtggggcaccacccggcactgttgactgag
tggggtaaggtcactgtgacctggtggagtcacgaggccaagggcttgcacaagaatgac
tttattatggctgcccgtactgacgagcaggtagacgcagcctag

DBGET integrated database retrieval system