KEGG   Microbulbifer sp. A4B17: BTJ40_08530Help
Entry
BTJ40_08530       CDS       T05421                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
mii  Microbulbifer sp. A4B17
Brite
KEGG Orthology (KO) [BR:mii00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mii03016]
    BTJ40_08530
Enzymes [BR:mii01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     BTJ40_08530
Transfer RNA biogenesis [BR:mii03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    BTJ40_08530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AWF80845
UniProt: A0A2S1JR02
Position
complement(1878009..1878752)
Genome map
AA seq 247 aa AA seqDB search
MTTQEPTILFEDDYLLAAYKPEGWLVHRSEIDRQEQRVLLQYLRNLCGNFLYPVHRLDKP
TSGVIIFAKSGDTAAQLQQQLESDLSSKKYIAVCRGYSPIDGIIDHALTPVADFKHQRKR
PKADLPRQQAITLYRRLETIELPHEVDRYPTSRYSLVEIQLKTGRRHQIRRHFKHIHHPL
IGCPKYGKSIHNRFFANEFNCHRLLLHATELKLQHPVSDSQLIIQCAVQGHFLQLIEQFD
WQALKSS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgactactcaagaaccaaccattctctttgaagacgactatcttcttgccgcttataaa
ccagaaggatggcttgttcacagatcagaaatagaccgccaagaacagcgggtgctcctg
caatacctgaggaatctatgtggtaactttctctatccagtacaccggttagataaaccc
acttctggcgttattatttttgccaaaagtggagatactgctgcacaactgcaacagcaa
cttgaaagtgatctatcatcaaaaaaatatattgctgtctgcagaggatacagtccaata
gatggcattattgaccatgccctgacaccggttgccgactttaagcaccaaaggaaacgt
ccaaaagcggacttgccacgacaacaggcgattacgctttatcgacggttagagacaatt
gaattaccccatgaagttgaccgctaccccactagtcgctattccctggttgagatccaa
ttaaaaactggccgacgacatcaaataagaagacacttcaagcatatccatcatccacta
attggctgcccgaagtatggaaaatctatccataatcgtttttttgccaatgaattcaac
tgccatcgactgctattgcatgcaaccgaattgaagctacagcatccggttagcgactct
caactaataatccaatgcgcggtccaaggtcacttcttacaattaattgagcaatttgat
tggcaagccctaaaaagcagctga

DBGET integrated database retrieval system