KEGG   Microbulbifer sp. A4B17: BTJ40_12485Help
Entry
BTJ40_12485       CDS       T05421                                 

Gene name
acnD
Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00640  Propanoate metabolism
mii01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BTJ40_12485 (acnD)
Enzymes [BR:mii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     BTJ40_12485 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AWF83447
UniProt: A0A2S1JYF3
Position
complement(2804749..2807346)
Genome map
AA seq 865 aa AA seqDB search
MNTDYRKSLPGTDLDYFDTRAAVDAIQTGAYAKLPYTSRILAENLVRRCEPAKLTDSLKQ
IIERKRELDFPWFPARVVCHDILGQTALVDLAGLRDAIADKGGDPAKVNPVVPTQLIVDH
SLAVEHPGFEKDAFEKNRAVEERRNEDRFHFINWTKTAFGNVDVIPPGNGIMHQINLEKM
SPVVQVREGVAFPDTCVGTDSHTPMVDALGVISVGVGGLEAESVMLGRASYMRLPHIVGV
ELTGKLQPGITGTDLVLALTEFLRRERVVGAYLEFYGEGASNLTLGDRATISNMTPEYGA
TAAMFSIDEQTIDYLKLTGRDDEQVALVEKFAKETGLWSDTLKDAEYERVLKFDLDTVGR
NLAGPSNPHALLPASELANRGIAKAWEEKAGEMPDGAVIIAAITSCTNTSNPRNMIAAGL
IARNANKLGLTRKPWVKSSLAPGSKTVKMYLEEADLLPDLEQMGFGVVAFACTTCNGMSG
ALDPKIQQEVIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
KDALGYDADGNPITLKDIWPSDEEIDAIVRQSVKPQQFRDVYIPMFEERDAAEEQGHALY
DWRPMSTYIRRPPYWEGALAGERSLKGMRPLAVLGDNITTDHLSPSNAILASSAAGEYLA
KMGLPEEDFNSYATHRGDHLTAQRATFANPKLLNEMVRDDNGEIRQGSLARVEPDGQVTR
MWEAIETYMDRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLIGM
GVLPLEFKPGTTRETLGIDGTENFDVIGERTPHATLTLLIHRANGETIEAPVTCRLDTAE
EVSIYEAGGVLQRFAKDFLEAEATA
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgattaccgcaaatcactgcccggtacagacctcgattatttcgatacccga
gccgctgttgacgcgatccagaccggagcctatgccaaactgccgtatacctcacgtatt
ctggcggaaaacctggtgcgtcgctgcgagccggcaaaactgaccgactccctgaaacag
attattgagcgcaagcgcgagttggacttcccttggtttccagcccgggttgtgtgccac
gacatcctcggccaaactgcgctggtagacctagccggtctgcgcgatgccattgccgat
aaaggcggtgatcccgccaaggtaaatccagtggttcccacccagttgattgtggatcac
tccctcgcggtagagcaccccggctttgagaaggatgcttttgaaaaaaatcgtgcggta
gaggagcgtcgtaacgaagatcgcttccactttatcaactggaccaaaaccgcatttgga
aacgtcgatgtgattccccccggtaacggcatcatgcaccagatcaatctggagaaaatg
tctccggtggtgcaggtgcgcgagggcgtggccttcccggatacctgtgtcggtaccgac
agccacacgccgatggtagatgctttgggtgtgatttctgtgggtgttggcggcctggaa
gctgagagcgtgatgctcggccgcgcctcttatatgcgtctgccgcatattgttggagtg
gagctcaccggaaagttgcagccgggtattactggtaccgacttggtattggctctcact
gaattcctgcgccgcgagcgcgtggtcggagcctacctggagttttacggtgagggggct
tccaacctgaccctgggcgatcgcgccactatttccaatatgactccggagtatggcgct
actgcggccatgttctctatcgatgagcaaaccatcgactacctcaaactcaccggccgc
gatgatgagcaggtagctttggtagagaagtttgccaaggaaacgggcctctggtccgac
accttgaaggatgccgaatacgagcgtgtactgaagtttgacctggacacagtgggtcgc
aaccttgctggcccctccaacccccatgcgcttctgccggcttcggaactggctaatcgc
ggtatcgctaaagcctgggaagagaaagccggtgagatgcccgatggtgctgtgattatt
gccgcgattaccagctgcaccaataccagtaacccgcgcaatatgattgccgcaggcctg
attgcccgcaatgcgaacaagctcggcctgacccgcaagccctgggtcaagtcctccctg
gcaccgggctccaaaacggtaaaaatgtatctggaagaggctgacctgctaccggatctg
gagcagatgggctttggcgtagtggctttcgcttgcactacctgtaacggcatgagcggt
gccctggacccgaaaatccagcaggaagtgatcgaccgcgacctgtatgcaaccgctgtc
ctgtccggaaaccgcaacttcgacggtcgtatccacccctatgccaagcaggctttcctg
gcttcaccgccactggtcgttgcctacgctattgccggcaccatccggttcgatattgaa
aaagatgcgctgggatacgatgccgatggcaacccgattaccttgaaagatatctggccc
agcgatgaagagatcgatgcgatcgtacgtcagagcgtgaagccacagcagttccgcgat
gtgtatattcccatgttcgaagagcgggatgccgcagaagagcagggccacgcactctac
gactggcgcccgatgagcacctatatccgccgtccaccttattgggaaggtgccctggca
ggcgagcgcagtttgaagggcatgcgcccgctggcggtgctgggtgacaatatcactacc
gaccacttgtctccgtccaatgccattctggccagcagtgctgctggtgaatacctggct
aagatgggattgccggaggaggactttaactcctacgcgacccaccgaggcgaccacctc
actgcccagcgtgcaactttcgctaacccgaagttactcaacgaaatggtgcgcgatgat
aacggcgagatccgtcagggctccctggctcgtgtcgaaccggatgggcaggttacccgt
atgtgggaagccatcgagacttatatggatcgcaagcagccactgattatcattgcaggc
gctgattatgggcagggctcttctcgtgactgggctgcgaaaggtgtgcgccttgccggt
gtggaggcgattgtggccgaaggcttcgagcgaattcatcgcaccaacctgattggcatg
ggtgtattgccgttggagtttaagccgggcactacccgtgaaaccctgggtatcgacggt
accgagaatttcgatgtaatcggtgagcgcactcctcatgccacgctgaccttgcttatc
caccgcgctaatggtgagacgattgaggctcctgttacatgtcgcctggataccgcagaa
gaagtttccatttatgaggctgggggtgttttgcagcgctttgccaaagacttcctcgaa
gcagaagcgacggcctga

DBGET integrated database retrieval system