KEGG   Microbulbifer sp. A4B17: BTJ40_12665Help
Entry
BTJ40_12665       CDS       T05421                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00360  Phenylalanine metabolism
mii00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mii00790  Folate biosynthesis
mii01100  Metabolic pathways
mii01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mii00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BTJ40_12665
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTJ40_12665
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTJ40_12665
Enzymes [BR:mii01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BTJ40_12665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AWF81610
UniProt: A0A2S1JT78
Position
2847741..2848544
Genome map
AA seq 267 aa AA seqDB search
MKKEAKKASKYVAREPNEDGFIEYTDLEHQTWQRLIERQLDVLPGRACDEYMHGLELLDL
PKDRIPQLEEISSVLRRETGWEVARVPALIGFETFFGLLADRKFPVATFIRTPEEFDYLQ
EPDIFHEIFGHCAMLTNPAFANFTQKYGQLGLKASPKERAYLARLYWFTVEFGLLNTDDG
LRIYGGGILSSPKETLYALSHQPERYDLDAVTALRTPYRIDIVQPIYYVLNSLQQLQELT
EIDLMAKVREAIELGLFEPRFPPKDAA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaagcaaagaaggcaagcaagtacgttgcccgtgagcccaatgaagacggc
tttatcgagtataccgaccttgaacaccaaacttggcagcgtctgattgaacgccaactg
gatgtcttacctggccgcgcctgcgatgaatatatgcacggcctggagctgttggaccta
ccgaaagaccgcataccccaactcgaggaaatctccagcgtgctgcgcagagaaactggc
tgggaagtcgcccgggttcccgcccttatcggcttcgaaacctttttcggtcttctagcg
gatcgtaagttcccagttgctacctttatacgcactcccgaagagtttgattatctgcag
gaaccggacatcttccacgagatttttggccactgcgccatgctcaccaacccagcattt
gcaaacttcacgcaaaaatacggacaactgggccttaaagcctcgcctaaagaacgcgcc
tatttagcccgcctctattggtttacagtggagttcggcctactgaacaccgacgatggt
ttgcgcatttacggtggcggcattctgtcttccccgaaagagacactctacgcactgagt
caccaaccagagcgctacgatttagacgcggttaccgcactgcgcaccccatatcgcatc
gatattgttcaacccatttactatgtcctcaacagcttgcaacaactgcaggaactgaca
gaaattgacctgatggccaaggtccgcgaggctattgagctgggactattcgaaccccgc
ttcccgcccaaagacgcagcctga

DBGET integrated database retrieval system