KEGG   Microbulbifer sp. A4B17: BTJ40_17615Help
Entry
BTJ40_17615       CDS       T05421                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mii  Microbulbifer sp. A4B17
Pathway
mii00970  Aminoacyl-tRNA biosynthesis
mii01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mii00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BTJ40_17615
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mii03029]
    BTJ40_17615
Enzymes [BR:mii01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BTJ40_17615
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BTJ40_17615
Mitochondrial biogenesis [BR:mii03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BTJ40_17615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AWF82486
UniProt: A0A2S1JVQ2
Position
complement(4005238..4006659)
Genome map
AA seq 473 aa AA seqDB search
MNDFVGMTALELLRGYRAKTFSPVEVAEELLNQIERLNRHVNAFCLVDRETSLAYARESE
RRYMFDAAKGLLDGVPVAVKDVFYTPMWPTVFGSQVIDPETTLGCAAPCIAALQRHGYIP
IGKTTLPEFGWKAVTDNAIDGITRNPWDRDRTPGGSSGGAAVAISLGLSPLAVGADGGGS
IRIPASFCGVVGFKPSFGQVPHWPLGTFSSLMHVGPLASTVEDCALMMNVISEPDYRDIR
GIPRRKFDFLAAIGGRQVAGIKKLRIAYSPSLGYANPDPIVERSVSDSVMLFQELGADVV
AVDPDIDDPSAAFGCLFCAGIASILRAMDSTRRQLVEPQLLEVAEQADKISLPDYLDVLK
WRDNFVERLQLFFLKYDLLVTPTLPITAFAAGVNVPENNPGSMWYSWTPYTYPFNLSGHP
AISLNCGFSKSGLPIGLQIVGRKYADEIVLCAAAALQSRQGLKVGLPDWVKTV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttcgttgggatgacagcccttgaactgttgcgtggatatagggcgaaaact
ttttcaccggttgaggttgccgaagagctgctcaaccaaattgagcgattaaacaggcat
gttaatgccttttgcctggttgatagagagacgagcctcgcctatgcgcgggaatcggag
cgccgctatatgttcgatgctgcgaaaggattactcgatggggtaccggtggcagtaaag
gatgtcttttatacgccgatgtggcctacggtttttggctcccaagtgattgatccagag
acaacactgggttgtgcagcgccctgtatcgctgcgctgcaacgccatggttacattcca
attggaaagaccacgttaccggaatttggttggaaagcggttacagataatgccattgat
ggtatcacgagaaatccatgggatagggatagaactccgggaggctccagcggtggggca
gcggtggctatatcactggggctgagcccattggcagtgggagccgacggcggcggatct
attcggattccagccagtttctgcggggttgtgggatttaaaccaagttttgggcaggtt
ccccactggccattaggaaccttctcttctttgatgcatgtgggaccgctggcgtcgact
gtggaggattgcgcactgatgatgaatgtaatcagtgagccggattaccgggatatccgg
ggaataccgcgacgtaaatttgatttcctcgcggcgatagggggcagacaggttgcgggg
ataaaaaaattacgtattgcctatagccccagtctcggctacgcaaaccctgatcccatc
gttgagcgcagtgtttctgatagtgtcatgctattccaggagttgggtgctgatgttgta
gcggttgatcctgatatagatgaccccagtgcagcttttggatgtctgttttgcgctgga
atagcgagtatcttaagggcgatggattccactaggcgtcaactggtagaaccccagtta
ttggaggtcgcagagcaagcagacaaaatatccttacccgattaccttgatgtactgaaa
tggcgcgataactttgttgagcgtttgcagcttttttttctgaaatatgatctgttggtg
accccgacattgccgattacggcctttgctgcaggtgtcaatgttcctgagaataatccc
ggttcgatgtggtactcctggacaccatatacctatcccttcaatttgtccgggcatccg
gcgatatcactcaattgtggtttttcaaagagtggtctgccgattggattgcagattgtg
ggcagaaaatatgctgatgagattgttttgtgtgccgctgctgccctgcaaagtaggcaa
gggttaaaagtgggcctccctgactgggtgaaaacagtgtaa

DBGET integrated database retrieval system