KEGG   Microbulbifer sp. A4B17: BTJ40_20045Help
Entry
BTJ40_20045       CDS       T05421                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mii  Microbulbifer sp. A4B17
Brite
KEGG Orthology (KO) [BR:mii00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BTJ40_20045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Fumarate_red_D
Motif
Other DBs
NCBI-ProteinID: AWF82927
UniProt: A0A2S1JWZ0
Position
4588249..4589523
Genome map
AA seq 424 aa AA seqDB search
MEIISQYGHILLILACVAGFFMAWGVGANDVANAMGTSVGSRALTIKQAIIIAMIFEFAG
AYLAGGEVTATIRKGIIDSEVFAAQPQLLVYGMLSALLAAGTWLLVASILGWPVSTTHSI
VGAIVGFSAVGISADAVAWGKVGSIVASWVVSPVLAGTISFLLFRSVQRLILDTEDPFNN
AKRYIPFYMFAVGWMIAMVTLTKGLKHVLKDANIQLSFIQDAGIAALVGLAVAGIGVAML
KRVQRDPEAEAENRFANVERVFAILMIFTACAMAFAHGSNDVANAVGPLAAVVNTIQSGA
ITVKSTMPSWILLLGGIGIVVGLATYGFKVMATIGKKITELTPSRGFAAELGAASTVVLA
SGTGLPISTTHTLVGAVLGVGLARGIGALNLRMITTIAASWVVTLPAGAGIAILFFYFFK
GLFG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtggaaattattagtcaatatggccatattttattgattttggcctgtgtggcaggcttc
tttatggcctggggcgtcggtgccaacgacgtagccaacgccatgggtacctccgtaggt
tcccgtgcactgactatcaaacaggcgattattatcgccatgatttttgaatttgccggt
gcctacctggctggtggggaagttaccgcaaccatccgcaaaggcattatcgattctgaa
gtcttcgccgcccaaccacagttgctggtatacggtatgctttcggcactgctggcagcg
ggcacatggctgctggtggccagtatcctcggctggccggtatccaccactcactctatc
gtcggcgcaattgtcggtttctctgcggtgggtatctctgcagatgcagtggcctggggc
aaagtaggcagtatcgtcgcaagctgggtggtctccccggtgctcgcgggcaccatttcc
ttcctgttattccgcagtgttcagcgcctgatcctggacacggaagaccccttcaacaac
gccaagcgctacatccccttctacatgtttgcagtgggctggatgattgccatggtaacc
ctcaccaagggcctcaagcacgttcttaaagacgccaacattcagctcagctttatccag
gatgccggtatcgccgctctggtaggccttgctgtcgccggtatcggtgtcgccatgctc
aaacgtgttcagcgcgacccggaagctgaggcagaaaaccgtttcgctaatgtcgagcgc
gtatttgccatcctgatgatctttaccgcctgtgctatggcctttgcccacggctccaac
gatgtcgccaatgccgttggccctctggcggccgtcgtcaataccatccagagcggtgcc
atcacggtcaagtccactatgccctcctggatattgctgctcggtggtatcggtatcgtg
gtaggcctggcgacttacggctttaaggtaatggccacaatcggtaagaaaatcaccgag
ctgacgccaagccgcggcttcgctgccgagctgggtgccgcatccaccgtggtattagcc
tcaggtaccggcctgccgatctccaccacccacaccctggtgggtgcggtattgggagtt
ggcctggcgcgaggtattggcgccttgaacctgcgtatgatcaccactatcgccgcctcc
tgggtagtcaccctgccagcgggtgcaggtattgcgatcctgttcttctacttcttcaaa
ggcctgttcggctaa

DBGET integrated database retrieval system