KEGG   Microlunatus sp. KUDC0627: FOE78_02805Help
Entry
FOE78_02805       CDS       T06101                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mik  Microlunatus sp. KUDC0627
Brite
KEGG Orthology (KO) [BR:mik00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FOE78_02805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QDP94987
UniProt: A0A516PUX4
Position
complement(650310..651728)
Genome map
AA seq 472 aa AA seqDB search
MTVALFVVICVIVVALIFDFTNGFHDSANAMAGPIATGALTPRIAVLLAAVLNVVGAMLS
TEVAKTISGGFFDDSLVTPQIVLAGLCGAIVWNLVTWLFGLPSSSSHALFGGLIGAVIVG
AGLASVNYSVVVSKMLLPAVVAPVVAGLAAAAGIKIADRVTRDVAKKDTKRGYRRAQAFT
AAMVALAHGTSDGQKTMGVITLVLIAAGLQASGTGPQWWVIGTAGLAIGLGTYSGGWRIM
RTMGKGIVKIDTEQGAAAGAATTATILASSHLGFGLSTTHVSTGSIMGSGVGRKGADVRW
GVARRMVYAWLLTLPAAAIVGGLAALLADQGMVGTIVLLALLGISCLIIWLASRRNQVDR
TNVTESPDVLVLNAAKPNKIAKAQRKEAKRREKERLRAEAVLREAEGLQRSEASDEVAEA
GIGSGSGSERPHASATAEQSSAEQRPAEQRATERSSEPARTESYEPTAGEER
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgacagttgccctgttcgtggtgatctgcgtcatcgtcgtcgctctcatcttcgacttc
accaacggcttccacgacagcgccaacgcgatggccggaccgatcgcgaccggcgctctg
acgccacggatcgccgtactgctggccgccgtgctcaacgtcgtcggcgcgatgctctcc
accgaagtcgccaagaccatctccggtggattcttcgacgacagtctggtgacgcctcag
atcgtcctggccggactctgtggcgcgatcgtctggaacctggtcacctggctgttcggg
ctcccctccagctcgtcccacgcgctgttcggcggcctgatcggcgccgtcatcgtcggc
gccggcctggcctcggtgaactactcggtcgtcgtctccaaaatgttgctgcccgccgtc
gtggcaccggtggtggccggcctggccgcggccgccgggatcaagatcgccgaccgggta
acccgcgacgtggcgaagaaggacaccaaacgcggctaccggagggcacaggccttcacc
gcagcgatggtcgcgctggcgcacggcacctccgacgggcagaagacgatgggcgtgatc
accctggtgttgatcgccgccggcctgcaggcctccggtaccggcccgcagtggtgggtg
atcggcaccgccgggctggccatcggactgggcacctattccggcggctggcggatcatg
cgcacgatgggcaagggcatcgtcaagatcgacaccgagcagggcgccgccgccggcgcc
gccaccacggccaccatcctcgcgtcctcgcacctcggtttcgggctgtcgacgacccac
gtgtcgaccggcagcatcatgggctcgggcgtcggccggaagggtgccgacgtgcgctgg
ggcgtcgcccggcggatggtgtacgcctggctgctgactctgccggccgccgccatcgtc
ggtgggctggccgcgctgctggccgatcagggcatggtcggcaccatcgtcctgctggca
ctgctgggcatctcgtgcctgatcatctggctcgcctcccggcgcaaccaggtcgatcgc
accaacgtcaccgagagccccgacgtgctggtgctgaacgccgccaagccgaacaagatc
gccaaggcgcagcgcaaggaagccaagcgacgcgaaaaggagcggctgcgggccgaagca
gtactccgagaagccgagggtcttcagcggtccgaggcatcggacgaagtagccgaagcc
ggcattggctccggttccggctccgagcggccccatgcgagcgcgaccgccgagcagagc
tctgccgaacagcgccctgccgagcaacgagcgaccgagcggtcgtccgaaccggcccgg
accgagagctacgagccgacggcaggtgaggaacgatga

DBGET integrated database retrieval system