KEGG   Microlunatus sp. KUDC0627: FOE78_08295Help
Entry
FOE78_08295       CDS       T06101                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mik  Microlunatus sp. KUDC0627
Pathway
mik00480  Glutathione metabolism
mik00590  Arachidonic acid metabolism
mik01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mik00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    FOE78_08295
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FOE78_08295
Enzymes [BR:mik01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FOE78_08295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: QDP95898
UniProt: A0A516PXK0
Position
complement(1839232..1839711)
Genome map
AA seq 159 aa AA seqDB search
MAVLSNFSATKITGDLADLGNYRGQVVLIVNTASKCGLTPQYAGLQKLYETYADRGLVIL
GFPCDQFGNQEPGSEAEIADFCELNYGVSFPMFAKIEVNGPGAHPLYQWLTTEQPGEDGP
AIEWNFAKFLINRDGELIKRYHPKVTPEDLAPDVESALA
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctctcgaacttctcggcgaccaagatcacgggtgacttggccgatctcggg
aactaccggggccaagtggtcctgatcgtcaacaccgcttcgaagtgcgggctgaccccg
caatacgctggtctgcagaagctgtacgagacctacgccgatcgcggcctggtgatcttg
ggattcccgtgtgatcagttcggcaaccaggagcccggctcggaggccgagatcgccgac
ttctgcgagctgaactacggggtgagcttcccgatgttcgccaagatcgaggtgaacggg
cccggcgcgcacccgctctaccagtggctgaccaccgagcagcccggcgaggacggaccg
gccatcgagtggaacttcgccaagttcctgatcaacagggacggcgagttgatcaagcgc
taccaccccaaggtgacccccgaggacctcgctcccgatgtggagtccgcgctcgcctga

DBGET integrated database retrieval system