KEGG   Micromonospora sp. L5: ML5_0614Help
Entry
ML5_0614          CDS       T01379                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mil  Micromonospora sp. L5
Pathway
mil03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mil00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ML5_0614
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mil03011]
    ML5_0614
Ribosome [BR:mil03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ML5_0614
  Bacteria
    ML5_0614
  Archaea
    ML5_0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADU06164
Position
complement(625225..625674)
Genome map
AA seq 149 aa AA seqDB search
MPGKGDAPVLPGARAVARHVRISPMKARRVVNLVRGLPAKEALTVLQFAPQAASEQVYKV
LASAIANAENNERLDPDALLVSEAFVDEGPTMKRFRPRAQGRAYRIRKRTCHITVAVEAV
AAATPKKSAKKAAPAKPAAEEQSTTEGAE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgccaggaaagggcgacgctccggtgcttccgggcgcgcgggcggttgcgcggcacgtg
cgcatctcgccgatgaaggcgcgccgggtggtcaacctcgtccgcggcctgcccgcgaag
gaggcgctcacggtgctgcagttcgcgccgcaggctgcgagcgagcaggtgtacaaggtg
ctcgcgagcgcgatcgccaacgcggagaacaacgagcggctggaccccgacgcgctgctc
gtcagcgaggcgttcgtcgacgagggcccgaccatgaagcggttccggccgcgtgcgcag
ggccgggcgtaccggatccgcaagcgcacctgccacatcaccgtggcggtcgaggcggtt
gcggcggccacgccgaagaagtcggcgaagaaggccgctccggccaagccggccgctgag
gagcagagcacgacggagggtgccgagtaa

DBGET integrated database retrieval system