KEGG   Micromonospora sp. L5: ML5_0955Help
Entry
ML5_0955          CDS       T01379                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mil  Micromonospora sp. L5
Pathway
mil00040  Pentose and glucuronate interconversions
mil00052  Galactose metabolism
mil00500  Starch and sucrose metabolism
mil00520  Amino sugar and nucleotide sugar metabolism
mil01100  Metabolic pathways
mil01130  Biosynthesis of antibiotics
Module
mil_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ML5_0955
   00052 Galactose metabolism
    ML5_0955
   00500 Starch and sucrose metabolism
    ML5_0955
   00520 Amino sugar and nucleotide sugar metabolism
    ML5_0955
Enzymes [BR:mil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ML5_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADU06496
Position
944579..945568
Genome map
AA seq 329 aa AA seqDB search
MSEHSANPSAAPGRSRAVKAVIPAAGLATRFLPATKAVPKELLPVVDRPVLQYIVEEAAQ
AGIDDILLITGRGKTSMVDHFDRRPDLEERLAKKPELLAEVKRTEELAAIYTVRQPEQLG
LGHAVGYAESHVGDAPFAVLLGDEFVKPSEPLLPAMLELQARTGGVVLAFFEVDPAETSR
YGIASVEPAESEYSDIAEVVKVTGMVEKPSPEDAPSNLAVLGRYVLPGKIFDAIRRTRPG
SGGEIQLTDAMELLRTEGVPVHAIVYRGTRYDTGMPLGYLQTVVQIAAEREDLGAEFRKW
LTEFVNNGDETVTAAVLNGIRDASGGADT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcactcagcgaacccctcagcggcccccggtcgctcccgcgcggtcaaggcc
gtgatcccggccgccggcctggccacccggttcctgccggccaccaaggcggttcccaag
gaactgctgccggtcgtcgaccggccggtgctgcagtacatcgtcgaggaggccgcccag
gccggcatcgacgacatcctgctgatcaccggtcgcggcaagacctcgatggtggaccac
ttcgaccgccggccggacctggaggaacggctcgccaagaagcccgagctgctggccgag
gtcaagcgcaccgaggaactcgcagcgatctacacagtccgccagccggaacagctcggc
ctcggtcacgccgtcgggtatgccgagtcgcacgtcggcgacgcgcccttcgcggtgctg
ctcggcgacgagttcgtcaagccctccgagccgctgctgccggccatgctggaactccag
gcccgcaccggcggcgtggtgctcgcgttcttcgaggtcgacccggccgagactagccgc
tacggcatcgcgtcggtcgagccggccgagtcggaatactccgacatcgccgaggtcgtc
aaggtcaccggcatggtggagaagcccagcccggaggacgcccccagcaacctcgccgtc
ctcggccggtacgtgctccccgggaagatcttcgacgcgatccggcgtacccgaccgggc
agcggcggcgagatccagctgaccgacgcgatggagctgctgcgtaccgagggggtgccg
gtgcacgccatcgtctaccggggcacccgctacgacaccggcatgccgctcggctacctc
cagaccgtggtgcagatcgccgccgagcgggaggacctgggggccgagttccgcaagtgg
ctgaccgagttcgtcaacaacggcgacgagacggtcaccgccgcggtcctcaacggcatc
cgcgacgcgtccggcggtgccgatacatga

DBGET integrated database retrieval system