KEGG   Micromonospora sp. L5: ML5_1024Help
Entry
ML5_1024          CDS       T01379                                 

Definition
(GenBank) rRNA (guanine-N(1)-)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
mil  Micromonospora sp. L5
Brite
KEGG Orthology (KO) [BR:mil00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mil03009]
    ML5_1024
Enzymes [BR:mil01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ML5_1024
Ribosome biogenesis [BR:mil03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ML5_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_12 Methyltransf_11 Methyltransf_31 MTS DNA_ligase_ZBD Methyltransf_33 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ADU06564
Position
complement(1015671..1016522)
Genome map
AA seq 283 aa AA seqDB search
MDDRILARLRCPVCAEPLTETTAGTARALRCPRGHSFDIARQGYVNLLAGRAPHTGDSAE
MVAARAGFLAAGHYDAVAAALATTAVRVAGSDAYPLVVDAGAGTGHYLAAVLAALPEAAG
LALDVSKPALRRAARAHSRAAAALADTWQRLPLADRSTSVLLNVFAPRNGPEFHRVLDPG
GALLVVTPAADHLTELVDALDLLRVDPDKADRVAGSLGAHFAEESATGHRARLALTRAEV
STLVGMGPSAWHADPRRLAARIAALPEPVPVTLSVRLGVHRPR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtggacgatcgcatcctcgcccggctgcgctgcccggtctgcgccgagccgctcaccgag
accaccgccggcaccgcacgcgcgctgcgctgcccgcgcgggcacagcttcgacatcgcc
cggcagggatacgtgaacctgctcgccggccgcgccccccacaccggggacagcgccgag
atggtcgccgcccgcgccggcttcctcgccgccggccactacgacgccgtcgccgccgcg
ctggcgaccacagcggtacgcgtcgcgggctccgacgcgtaccccctggtcgtggatgcc
ggcgccgggaccgggcactacctcgcggcggtgctggcggcgctgcctgaggccgccggc
ctggccctggacgtctccaagccggcgctgcgccgcgcggcccgggcgcattcgcgggcc
gccgccgcgctcgccgacacctggcagcggctgcccctagccgaccggtccacctcagtg
ctgctgaacgtgttcgcgccgcgcaacggcccggagttccaccgggtgctcgacccgggc
ggcgcgctgctggtggtcaccccggccgccgaccacctgaccgaactcgtcgacgcgctg
gacctgctgcgggtcgacccggacaaggccgaccgggtcgccggcagcctcggcgcccac
ttcgccgaggagtccgcgaccgggcaccgggcccggctcgcgctgacccgcgccgaggtc
agcacactcgtcgggatgggaccgagcgcctggcacgccgacccgcgacggctcgccgcg
cgcatcgccgcgctgcccgagccggtgccggtcacgctctccgtccggctcggcgtgcac
cgcccgcgctga

DBGET integrated database retrieval system