KEGG   Micromonospora sp. L5: ML5_1218Help
Entry
ML5_1218          CDS       T01379                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
mil  Micromonospora sp. L5
Pathway
mil00330  Arginine and proline metabolism
mil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ML5_1218
Enzymes [BR:mil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ML5_1218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADU06757
Position
1225880..1226893
Genome map
AA seq 337 aa AA seqDB search
MTRYGPMYGPDITFLGVPPCTVEEPVTYADADVVIIGAPFDGGTSHRPGTRFGPSAIRQA
CYLPHDGSRPSLALRVDGLKDLCVYDAGDVEMFSGDIERSLAALETAVHAVAAAGAIPVV
LGGDHSIALPDATGVARHHGLGRVSLVHFDAHADTGDVEFGSLHGHGQPMRRLIESGAVR
GDRFLQIGLRGYWPGPDTLAWMAEQRMRSYEMTEIVARGLDTCLTEAFGIATDECEGVFL
SVDVDVVDPGMVPGTGTPEPGGFTSRQLLDAVRRVCYELPVVGLDVVEVAPPYDHADITA
YLGNRVVLEALSAIARRRHDAAGGPPWNPTQPLLDNR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacccggtacggcccgatgtacggtcccgacatcacgttcctcggcgtgccaccgtgc
acagtcgaggaaccggtcacgtacgccgacgcggacgtggtgatcatcggggcgccgttc
gacggcggcacctcgcaccggccgggcacccggttcgggccgtccgccatccggcaggcc
tgctacctgccgcacgacggctcccgcccgtcgctggcgctgcgcgtcgacgggctgaag
gacctgtgcgtctacgacgccggcgacgtggagatgttcagcggcgacatcgagcgctcg
ctggccgcgctggagaccgccgtgcacgcggtcgccgccgccggggcgatccctgtggtg
ctcggcggcgaccactccatcgcgctgcccgacgccacaggcgtggcccggcaccacggg
ctcggccgggtgtcgctcgtgcacttcgacgcgcacgccgacaccggcgacgtcgagttc
ggctcgctgcacggccacggccagccgatgcgccggctcatcgagtccggcgcggtacgc
ggtgaccgtttcctccagatcgggctgcgcggctactggcccggcccggacacgctggcg
tggatggcggaacagcggatgcgctcgtacgagatgaccgagatcgtggcgcgcggcctg
gacacgtgcctcaccgaggcgttcggcatcgcgaccgacgagtgtgagggcgtgttcctc
tccgtcgacgtggacgtggtcgacccgggcatggtgccgggcaccggcacgcccgagccg
ggcgggttcacctcccggcaactgctcgacgcggtgcgccgggtctgttacgagctgccg
gtggtcgggctggacgtggtcgaggtcgccccgccgtacgaccacgccgacatcaccgcg
tacctgggcaaccgggtggtgctggaggcgctgtccgcgatagcccgccgccgccacgac
gccgccggcggacccccgtggaaccccacccagccgctcctggacaaccgctga

DBGET integrated database retrieval system