KEGG   Micromonospora sp. L5: ML5_2610Help
Entry
ML5_2610          CDS       T01379                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mil  Micromonospora sp. L5
Pathway
mil00790  Folate biosynthesis
mil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ML5_2610
Enzymes [BR:mil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ML5_2610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ADU08132
Position
2731607..2732224
Genome map
AA seq 205 aa AA seqDB search
MAARLISGKLTGGPVEDSVDLARIEKAVREILIAVGEDPDRDGLQQTPARVARAYAELFA
GLRVDPAQVLRTTFEANHEELVLVRDIDVMSLCEHHLLPFRGSAHIGYIPGPDGRITGLS
KLARLVEVFARRPQVQERLTSQIADLLMSSLAPRGVIVVLECEHMCMAMRGIQKSGAKTI
TSAVRGGLQNDAKSRAEAMALIMAR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgcgcctgatcagcggcaagctcaccggtggcccggtggaggacagcgtcgac
ctcgcccggatcgagaaggcggtccgcgagatcctcatcgctgtcggcgaggacccggac
cgtgacggcctccagcagacgcccgcccgggtcgcccgcgcgtacgccgaactcttcgcc
ggcctgcgggtcgaccccgcgcaggtgctccgcaccacgttcgaggccaaccacgaggag
ctggtgctcgtccgggacatcgacgtgatgagcctctgcgagcaccacctgctgccgttc
cggggcagcgcgcacatcggctacatccccggcccggacggccggatcaccggcctgtcc
aagctggcccggctggtcgaggtgttcgcccgccgaccgcaggtgcaggagcggctcacc
tcgcagatcgccgacctgctgatgtccagcctcgccccgcgcggcgtgatcgtggtgctg
gagtgcgagcacatgtgcatggcgatgcgcggcatccagaagtcgggcgcgaagaccatc
acgtccgccgtgcgcggcggactgcagaacgacgcgaagtcgcgggccgaggcgatggca
ctgatcatggcccgctga

DBGET integrated database retrieval system