KEGG   Micromonospora sp. L5: ML5_2716Help
Entry
ML5_2716          CDS       T01379                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mil  Micromonospora sp. L5
Pathway
mil00010  Glycolysis / Gluconeogenesis
mil00052  Galactose metabolism
mil00500  Starch and sucrose metabolism
mil00520  Amino sugar and nucleotide sugar metabolism
mil00521  Streptomycin biosynthesis
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
mil01120  Microbial metabolism in diverse environments
mil01130  Biosynthesis of antibiotics
mil01200  Carbon metabolism
Module
mil_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ML5_2716
   00052 Galactose metabolism
    ML5_2716
   00500 Starch and sucrose metabolism
    ML5_2716
   00520 Amino sugar and nucleotide sugar metabolism
    ML5_2716
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ML5_2716
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ML5_2716
Enzymes [BR:mil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ML5_2716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADU08235
Position
complement(2846096..2847028)
Genome map
AA seq 310 aa AA seqDB search
MSAGDEVVVALDVGGTGMKCALVRPDGTTVHTERHATDAQRGPEAVVGTILDVAEGLAGK
ARADGRTPVACGIAVPGVVDEARGVAVWSANVGFRDVPLRELAGTRLGLPAALGHDVRAG
GLAEARLGAGRDGGHVLFVAIGTGIAAAHVVDGSAATGAHGAAGEIGHILVRPGGPRCGC
GRTGCLEAVSSASAIGRRYAELSGAPTTAAQVADRAAAGEPLAVEVWQEAVEALADGLAT
GQALYDVSTVVLGGGLAQAGPRLFDPLRTALRERLTFHREPRLVAADLGDEAGCLGAALL
ALDTLAKESR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaggcgacgaggtcgtcgtcgcgctggacgtgggcggcaccgggatgaagtgc
gccctggtccggccggacggcacgactgtgcacaccgaacggcacgccaccgacgcgcag
cgcggcccggaggccgtggtcggcacgatcctcgacgtggccgaagggctcgccggcaag
gcccgcgccgacggccgcaccccggtggcctgcggcatcgccgtacccggagtggtcgac
gaggcgcgcggcgtggcggtctggtcggcgaacgtgggcttccgggacgtacccctgcgg
gagctggcgggcacgcggctgggactgccggcggcgctcggccacgacgtgcgggcgggc
ggcctggccgaggcccggctcggcgccggacgggacggcgggcatgtgctgttcgtcgcg
atcggcaccggcatcgccgccgcccacgtggtcgacgggtcggccgccaccggcgcgcac
ggcgccgccggggagatcggccacatcctggtacgccccggcggcccgcgctgcgggtgc
gggcggaccggctgtctggaggcggtgtcgtcggcgtcggcgatcggacgccggtacgcc
gagctgtcaggtgcgcccaccaccgccgcccaggtggccgaccgggcggccgccggtgag
ccgctcgccgtggaggtgtggcaggaggcggtcgaggcgctcgccgacggactcgccacc
gggcaggcgctctacgatgtctcgacagtggtgctcggcggcgggctggcccaggccggt
ccccggctgttcgacccgctgcggacggcgttgcgcgagcggctgacgttccaccgcgag
ccgcgcctggtcgcggccgacctcggtgacgaggccggctgcctgggcgccgccctgctg
gccctggacaccctggcgaaggagagtcgatga

DBGET integrated database retrieval system