KEGG   Micromonospora sp. L5: ML5_2821Help
Entry
ML5_2821          CDS       T01379                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mil  Micromonospora sp. L5
Pathway
mil00010  Glycolysis / Gluconeogenesis
mil00260  Glycine, serine and threonine metabolism
mil00680  Methane metabolism
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
mil01120  Microbial metabolism in diverse environments
mil01130  Biosynthesis of antibiotics
mil01200  Carbon metabolism
mil01230  Biosynthesis of amino acids
Module
mil_M00002  Glycolysis, core module involving three-carbon compounds
mil_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ML5_2821
  Energy metabolism
   00680 Methane metabolism
    ML5_2821
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML5_2821
Enzymes [BR:mil01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ML5_2821
Membrane trafficking [BR:mil04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ML5_2821
Exosome [BR:mil04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ML5_2821
  Exosomal proteins of melanoma cells
   ML5_2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADU08340
Position
2952359..2953126
Genome map
AA seq 255 aa AA seqDB search
MTASEGPTVGTLVLLRHGESDWNAKNLFTGWVDVDLTTKGETEARRGGELLREHDLLPDV
VHTSLMRRAIRTAELALNAADRHWIAVRRSWRLNERHYGALQGKDKKQTLDEYGEEQFML
WRRSYDTPPPPIDDADEWSQVGDPRYALLPTELMPRTECLKDVVDRMLPYWYDSIVPDIL
AGRTVLVAAHGNSLRALVKHLDQISDDAIAKLNIPTGIPLRYDLDADLRPQVLGGTYLDP
DAAKAAAAAVANQGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgagcgaggggcccaccgtcgggacgctggtcctgctgcggcacggcgagagc
gactggaacgccaagaacctcttcaccggctgggtcgacgtcgacctgaccaccaagggg
gagaccgaggcgcggcgcggcggcgagctgctgcgcgagcacgacctgctgccggacgtg
gtgcacacgagcctgatgcgccgagccatccgcaccgccgagctggcgctgaacgccgcc
gaccggcactggatcgcggtacgccggtcgtggcggctcaacgaacgccactacggcgcc
ctgcagggcaaggacaagaagcagaccctcgacgagtacggcgaggagcagttcatgctc
tggcgccgctcgtacgacacgccgccgccgccgatcgacgacgcggacgagtggtcgcag
gtcggcgacccccggtacgcgctgctgccgaccgagctgatgccgcgcaccgagtgcctg
aaggacgtcgtcgaccggatgctgccctactggtacgactcgatcgtgccggacatcctg
gccggccggacggtgctggtggccgcgcacggcaactcgctgcgcgccctggtcaagcac
ctcgaccagatctccgacgacgcgatcgccaagctgaacatccccaccggcatcccgctg
cgctacgacctggacgccgacctgcggccgcaggtgctcggcgggacgtacctggacccg
gacgcggcgaaggctgccgccgccgcggtcgccaaccagggccgctga

DBGET integrated database retrieval system