KEGG   Micromonospora sp. L5: ML5_3153Help
Entry
ML5_3153          CDS       T01379                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mil  Micromonospora sp. L5
Pathway
mil00260  Glycine, serine and threonine metabolism
mil00750  Vitamin B6 metabolism
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
mil01120  Microbial metabolism in diverse environments
mil01230  Biosynthesis of amino acids
Module
mil_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML5_3153
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ML5_3153
Enzymes [BR:mil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ML5_3153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADU08670
Position
3304412..3305461
Genome map
AA seq 349 aa AA seqDB search
MWRGLIEAYRDRLPVTGATPVVTLHEGNTPLLPAPVLSARVGADVWLKVEGANPTGSFKD
RGMTVAVSKAVEAGDKAIICASTGNTSASAAAYAARAGITCAVLVPQGKIALGKLAQALV
HGAKLLQVQGNFDDCLGLAGKLAQDYPVALVNSVNIDRLHGQKTAAFEIVEALGDAPDIH
CLPVGNAGNITAYWMGYSEDLRDGNATKAPRMYGFQAAGAAPIVTGQVVPEPSTIATAIR
IGNPASWTKAIDARDASDGLISAVTDREILSAYRLLAREVGAFVELGSAASVAGLLQQAE
AGRVPAGSRVVCTVTGHGLKDPEWAISTAPAPVTIANDALAAARSLDLV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggggactgatcgaggcgtaccgggatcggctgccggtcaccggggcgactccc
gtcgtcaccctgcacgagggcaacacgccgctgctgccggcaccggtgctctccgcccgg
gtcggcgcggacgtgtggctcaaggtcgagggcgccaacccgaccggctcgttcaaggac
cgcggcatgactgtcgcggtctccaaggccgtcgaggccggtgacaaggcgatcatctgc
gcctccaccggcaacaccagcgcatccgccgccgcgtacgcggcccgtgccgggatcacc
tgcgcggttctggtgccgcagggcaagatcgcgctgggcaagctggcccaggcgctcgtg
cacggcgcgaagctgctccaggtgcaggggaacttcgacgactgcctcgggctcgccggc
aagctcgcccaggactacccggtcgcgctggtcaactccgtcaacatcgaccggctgcac
ggccagaagaccgccgccttcgagatcgtcgaggcgctcggcgacgcgcccgacatccac
tgcctgccggtcggcaacgccggcaacatcaccgcgtactggatgggctactccgaggac
ctgcgcgacggcaacgccacgaaggccccccggatgtacggcttccaggcggccggcgcc
gctcccatcgtcaccggtcaggtggtgccggagccgtcgacgatcgccaccgccatccgg
atcggcaacccggcgagctggacgaaggccatcgacgcgcgggacgcctccgacggcctg
atctcggcggtcaccgaccgggagatcctgtcggcgtaccggctgctggcccgcgaggtg
ggcgccttcgtcgagctgggcagcgcggccagcgtcgccggtctgctccagcaggccgaa
gccgggcgggtgccggccgggtcgcgggtggtctgcacggtcaccgggcacggcctgaag
gacccggagtgggccatctccaccgcgccggccccggtgaccatcgccaacgacgcgctg
gccgccgcccgctcgctcgacctggtctga

DBGET integrated database retrieval system