KEGG   Micromonospora sp. L5: ML5_4271Help
Entry
ML5_4271          CDS       T01379                                 

Definition
(GenBank) tryptophan 23-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
mil  Micromonospora sp. L5
Pathway
mil00380  Tryptophan metabolism
mil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    ML5_4271
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     ML5_4271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: ADU09769
Position
complement(4534504..4535208)
Genome map
AA seq 234 aa AA seqDB search
MKQDHSPVLPGDGATDYARYMRLNTLLALQRRPDEMMHRDELLFQVVHQSTELWLKLIAA
ELAEAVTRLRVGELAVTESLLTRATLGIRLVTDQLEMFRHLSPADFQAMQPALGKGSGAE
SPGWRQVHAMSRQLGRAFAEHLEVRGIEPAALGRPDPADPVQRLAEALIEWDERVSLWRM
RHYRVALRVGGHDPGGAEATMLAKFVGHRFFPALWRARLKPSDGSANESQADQR
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaggaccactcacctgtgctgcccggcgacggcgccacggactatgcgcgctac
atgcgactgaacacgctgctcgccctgcaacgacggccggacgagatgatgcaccgcgac
gagttgctcttccaggtggtgcaccagtccaccgagttgtggctgaagctcatcgccgcc
gagttggccgaggcggtcacccggctgcgcgtcggcgagctggcggtgaccgagtcgctg
ctaacccgggcgacgttggggatccgactggtcaccgaccagctggagatgttccggcac
ctgtccccggccgacttccaggccatgcaaccggcgctgggtaagggatccggggccgag
tcacccggatggcggcaggtccacgctatgagccggcagctcggccgggcgttcgccgag
cacctcgaagtccgaggaattgaaccggccgcactgggtcggccggatcccgccgacccc
gtccagcggctcgccgaggcgctcatcgagtgggacgagcgggtgtcgctgtggcgtatg
cggcactaccgggtcgctctgcgcgtcgggggccacgatcccggcggcgccgaggcgacg
atgctcgccaagttcgtcgggcaccggttcttccctgcactgtggcgggcccgcctgaag
ccctccgacggatccgctaacgaatcacaggccgaccaacgttga

DBGET integrated database retrieval system