KEGG   Micromonospora sp. L5: ML5_4438
Entry
ML5_4438          CDS       T01379                                 

Definition
(GenBank) protein of unknown function DUF1486
  KO
K15945  C-1 hydroxylase
Organism
mil  Micromonospora sp. L5
Pathway
mil01057  Biosynthesis of type II polyketide products
mil01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mil00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    ML5_4438
SSDB
Motif
Pfam: SnoaL SnoaL_2 DUF4440
Other DBs
NCBI-ProteinID: ADU09915
Position
4716669..4717088
AA seq 139 aa
MSPLENKNRCLQMVAAWNRADVSGVTEHWAPDVTHYNLDGEPHDTELVLTAMRGSLVSFS
DLRLEVRSILAEGDRVMLRLTATATHSGEFAGIPATGRKVTWHYLEELRFNEEGKVVEHW
DIFDFAPLFRELGHPAPAL
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtcgccgctggagaacaagaatcgctgcctgcagatggtcgccgcctggaaccgggca
gacgtgtcgggggtgactgagcactgggcgcccgacgtcacgcattacaacctggacggc
gagccacacgacaccgaactcgtcctgacggcgatgcgtggctcgctggtgtccttctca
gacctgcgactcgaagtgaggagcatcctcgcggaaggcgaccgggtgatgctccggttg
accgcgaccgccacgcacagcggtgagttcgccgggataccggcgaccgggcggaaggtc
acctggcactacctcgaggagctgcgcttcaacgaggagggcaaggtcgtcgagcactgg
gacatattcgacttcgccccgctgttccgggaactcggccacccggcaccggcgctctga

DBGET integrated database retrieval system