KEGG   Micromonospora sp. L5: ML5_4985Help
Entry
ML5_4985          CDS       T01379                                 

Definition
(GenBank) hypothetical protein
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
mil  Micromonospora sp. L5
Pathway
mil00340  Histidine metabolism
mil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ML5_4985
Enzymes [BR:mil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     ML5_4985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4 DUF2259
Motif
Other DBs
NCBI-ProteinID: ADU10458
Position
5402374..5403156
Genome map
AA seq 260 aa AA seqDB search
MCRHLAYLGPPVLLRSLLSDPPYGLLRQSWAPRDMRGGGTINADGFGVAWYPDDGDPVRY
RRAQPMWSDTTLPELAAVTRVRAVLAAVRSATVGMPLHETAAAPFAEGRWLFSHNGVVKG
WPDSLVPLAAGLPVRDLITLDVPTDSALLWALVRHRLRAGAPPDEAVADTVAAVAAAAPG
SRLNLLLTDGTTVVASTAGHALSVRRGPDSVLLASEPFDDDPAWRAVPDGRLVVATTGGL
DVRETTAVRRSVPTAREDTR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgtcacctcgcgtatctcggtccacccgtgctcctgcgcagcctgctgtccgac
ccgccgtacgggctgctgcgccagtcgtgggcgccgcgtgacatgcgtggcggcggcacg
ataaacgccgacggtttcggcgtcgcctggtatcccgacgacggcgacccggtccgctac
cggcgggcccagccgatgtggagcgacaccacactgccggagctggccgccgtgacgcgg
gtgcgggcggtgctggccgcggtccgatccgccaccgtcggcatgccgctgcacgagacc
gccgcggcgcccttcgccgaggggcggtggctgttcagccacaacggcgtggtgaagggc
tggccggacagcctggtcccgctcgccgccggcctgcccgtgcgcgacctgatcacactc
gacgtgccgaccgactcggcgctgctgtgggcgctggtccggcaccggctgcgggccggc
gcgccaccggacgaggcggtggcggacaccgtcgcggcggtcgccgccgccgctcccggc
tcgcggctgaacctgctgctcaccgacggtacgactgtggtggcgagcacggccgggcac
gcgctgtcggtgcgccgcggcccggactcggtgctgctggcgtccgaaccgttcgacgac
gacccggcctggcgggccgtgccggacggccggctcgtggtggcgaccacgggcgggctc
gacgtgcgggagacgaccgccgtccgacgatccgtacccaccgcaagagaggacactcga
tga

DBGET integrated database retrieval system