KEGG   Microbacterium sp. CGR1: AKG07_06100Help
Entry
AKG07_06100       CDS       T04046                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
mim  Microbacterium sp. CGR1
Brite
KEGG Orthology (KO) [BR:mim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mim03009]
    AKG07_06100
Enzymes [BR:mim01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     AKG07_06100
Ribosome biogenesis [BR:mim03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AKG07_06100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AKV85939
Position
complement(1264072..1264992)
Genome map
AA seq 306 aa AA seqDB search
MEFRTLPVPDGLDGTRVDAALAKMLGFSRTFAAEVASAGGVRVDGVTLDKSDRLRGGGWL
EVEWQPKEEPRIIPIAVPELGIVYDDDDIVVVDKPTGVAAHPSLGWEGPTVVGALAAAGF
RVATSGAPERQGIVHRLDVGTSGLMVVAKSETAYSSLKHAFKERTVEKIYHAVVQGHPDP
LTGTIDAPIGRHPNHSWKFAVVPDGKPSVTHYETLEAFPGASLLEIHLETGRTHQIRVHM
AALRHPCAGDPLYGADPTLSARLGLTRQWLHAHKLAFTHPATGEWVQFESGYPADFERAL
EILRGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaattccgcaccctccccgttcctgacgggctggacgggacgcgcgtcgacgcggca
ctcgcgaagatgctgggcttctcgcgcaccttcgccgccgaggtcgcctcggcgggcggc
gtgcgcgtcgacggggtgacgctcgacaagtccgatcgcctgcgcggcggagggtggctc
gaggtggagtggcagccgaaggaggagccgcggatcatcccgatcgcggttccggagctc
ggaatcgtctacgacgacgacgacatcgtcgtggtcgacaagcccacgggcgtcgccgct
catccctcgctcggatgggaggggccgaccgtcgtcggcgctctcgcagcggcggggttc
cgggtcgccacgagtggcgctccggagcggcaggggatcgtgcatcgtctggatgtcggc
accagcgggctcatggtcgtcgccaagagcgagacggcgtactcgtcgctgaagcacgcg
ttcaaggagcgcacggtggagaagatctatcacgccgtcgtccaggggcaccccgacccg
ctgacggggacgatcgatgctccgatcggccggcatccgaatcactcctggaagttcgcc
gtcgttcccgacggcaaaccgtcggtgacccactatgagaccctcgaggccttcccggga
gcctcgctgctcgagatccatctcgagaccggacgcacgcaccagatccgcgtgcacatg
gcggccctacggcacccgtgcgcgggcgacccgctctacggagcggatccgacgctgtcg
gcacggctcggactcacccgacagtggctgcacgcgcacaagctcgccttcacccacccg
gcgacgggggagtgggtgcagttcgagtcggggtaccccgcggatttcgaacgtgccctg
gagatcctgcgcggcgagtga

DBGET integrated database retrieval system