KEGG   Microbacterium sp. CGR1: AKG07_06795Help
Entry
AKG07_06795       CDS       T04046                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
mim  Microbacterium sp. CGR1
Pathway
mim00471  D-Glutamine and D-glutamate metabolism
mim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AKG07_06795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mim01011]
    AKG07_06795
Enzymes [BR:mim01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     AKG07_06795
Peptidoglycan biosynthesis and degradation proteins [BR:mim01011]
 Precursor biosynthesis
  Racemase
   AKG07_06795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Apo-VLDL-II
Motif
Other DBs
NCBI-ProteinID: AKV86049
Position
complement(1406837..1407670)
Genome map
AA seq 277 aa AA seqDB search
MNDAPIGIFDSGVGGLTVARAIRAQLPRESFVYIGDTAHSPYGPKPIADVRRYSLEVLDS
LVDQGVKMLVIACNTASAAMLRDARERYDIPVVEVIGPAVRRAVSTTRNGRVGVIGTVGT
IGSRAYQDMLEVNERLEVFTAACPRFVEFVEGGITGTPEVLATAEEYLAPLREADVDTLV
LGCTHYPFLRGAISYVMGEGVTLVSSDDETAGDVYRQLVRGDLLASPDATATYVYEATGD
STTEFTALANRLMGREVRDVQLVQTGVITLPEPVPGQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgccccgatcggaatcttcgactccggtgtcggcggactcacggtggcccgg
gccatccgagcccagctgccccgggaatcgttcgtctacatcggcgacacggctcactcg
ccctatggccccaagccgatcgcggacgtgcggcgctacagcctcgaagtactcgattcc
ctggtcgaccagggcgtcaagatgctcgtgatcgcctgcaacacggcatcggcggccatg
ctgcgcgacgccagagagcgctacgacattccggtcgtcgaggtgatcggcccggcagtg
cgacgagccgtgtcgacgactcgcaacggccgcgtcggggtcatcggcaccgtggggacg
atcggctcccgcgcctaccaggacatgctcgaggtgaacgaacggctcgaggtcttcacc
gcggcgtgcccgcgcttcgtcgagttcgtcgaggggggcatcaccggcacgcctgaagtg
ctcgccaccgccgaggagtacctcgcgccgctccgcgaggcggatgtcgacacactcgtt
ctcggctgcacccattaccccttcctgcgtggcgcgatcagctacgtgatgggggagggg
gtgaccctcgtctcgagtgatgacgagaccgccggggatgtctatcgccagctcgtgcga
ggcgatcttctcgcgtctcccgacgccacggccacgtacgtctacgaggcgacgggggac
tcgacgaccgagttcaccgccctcgccaaccgcctgatgggccgggaggtgcgcgacgtg
cagctcgtgcagaccggtgtcatcacgcttccggagcctgtccccggacagtag

DBGET integrated database retrieval system