KEGG   Microbacterium sp. CGR1: AKG07_08580Help
Entry
AKG07_08580       CDS       T04046                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mim  Microbacterium sp. CGR1
Pathway
mim03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mim00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AKG07_08580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mim03011]
    AKG07_08580
Ribosome [BR:mim03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AKG07_08580
  Bacteria
    AKG07_08580
  Archaea
    AKG07_08580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AKV86345
Position
complement(1760097..1760495)
Genome map
AA seq 132 aa AA seqDB search
MVESIARVRHIRVTPQKARRVVALIKGKQAQEALAILKFAQQSASEPIYKLVASAMANAQ
VKADRDGEYLDEQDLYVANAYVDEGTTLKRFQPRAQGRAFQIKKRTSHITVVLSTPEAAP
AAASDSNKKASK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggtggagtccatcgcacgcgtgcgacacatccgcgtgacccctcagaaggctcgtcgt
gtcgtcgcgctcatcaagggcaagcaggcccaggaggctctggcgatcctgaagttcgca
cagcagagcgccagtgagccgatctacaagcttgtcgcgtcggccatggccaacgcacag
gtcaaggcggatcgtgacggcgagtacctcgacgagcaggacctgtacgtggctaacgcc
tacgtagacgaggggacgacgctcaagcgtttccagcctcgtgcacagggtcgcgctttc
cagatcaagaagcgcacgagccacatcacggtcgtgctctcgacgcctgaggcggctccg
gccgctgcaagcgacagcaacaagaaggcgagcaagtaa

DBGET integrated database retrieval system