KEGG   Methylacidiphilum infernorum: Minf_0011Help
Entry
Minf_0011         CDS       T00727                                 

Gene name
purA
Definition
(GenBank) Adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
min  Methylacidiphilum infernorum
Pathway
min00230  Purine metabolism
min00250  Alanine, aspartate and glutamate metabolism
min01100  Metabolic pathways
Module
min_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:min00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Minf_0011 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Minf_0011 (purA)
Enzymes [BR:min01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Minf_0011 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt Radical_SAM Fer4_12
Motif
Other DBs
NCBI-ProteinID: ACD82071
UniProt: B3DWH6
Position
8155..9423
Genome map
AA seq 422 aa AA seqDB search
MNSVLVGAQWGDEGKGKIVDFLTQDADVVVRCQGGDNAGHTVEVNNEKFVLHLIPSGILW
PEKICLLGSGMVIDPVSLVEEIKNIEGRGIEIRNRLFISETAHMVFPYHRIIDELLEKNR
GKSRIGTTRKGIGPAYADKISRTGLRILDLLDKKSFLEKFQRLVEEKNRYIQFLGGEPLD
WKEIAEPYLKAADEISTMVVNTAIWLYEASALQKNILFESAQGTFLDIDFGTYPFVTSSN
TTAGGAITGSGLPPHKISRVIGCMKAYTTRVGEGPFPVENRELSEMLHASGREFGSTTGR
ARRCGWFDGVLARYASLINGFDEVAVTNLDGLDSMEKIPVCVSYEFKGKILKYPPNSVRQ
LEECVPIYEELPGWLESTAKVRSFEKLPQAAQNYLNKLGMLAGAPVRIVSVGASRDQTFF
VD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaattccgttcttgtcggtgctcaatggggagatgaaggaaagggaaaaattgttgat
tttctaactcaagatgcagatgtagttgttcgctgccagggcggtgataacgcaggtcat
acggttgaagtcaacaatgaaaagttcgttctccatctgattccctcgggcattttatgg
cctgaaaagatctgtttgctaggcagcggcatggttatagatcccgtttctcttgttgaa
gaaatcaaaaacatagaaggcagggggatagaaattcgaaaccggctttttatttctgaa
actgcccacatggtattcccttaccataggatcattgatgaactgcttgaaaaaaaccgg
ggcaaaagccgaattggaacaacgagaaaaggaataggtccggcttatgccgataaaata
agtcggactggtcttcgtattcttgatcttcttgataaaaaaagtttcttggaaaaattt
caaaggctggttgaggaaaaaaatcgttatatccagtttttagggggagaacccttggat
tggaaggaaattgcagaaccttatttaaaagccgctgatgagatttctacgatggtcgtc
aacaccgccatctggctttacgaggcttcggctttacaaaaaaacatcctctttgaaagc
gcgcaagggacttttctcgatattgactttggaacatatccttttgtaacctcctccaat
accacggcaggtggagctattacagggagcggattacctccccataaaattagccgtgtt
atcgggtgcatgaaagcctatacaacgcgggtgggagaaggtccgtttcctgtggaaaac
agggagctttcggaaatgctccatgcctctggcagggaatttggatcgacaacgggtagg
gcgagaagatgtggatggtttgacggtgttttagcccggtatgcttccctgatcaacggt
tttgacgaggtggctgtaaccaacctggatggacttgattccatggagaaaattcccgtc
tgtgtttcttacgagttcaaaggcaagatcctcaaatatcctcccaactccgtgcgccag
ctagaagagtgtgttcccatatatgaagaactaccgggatggttggagtctacagcaaag
gtacgttcttttgaaaaacttcctcaagctgctcaaaattacttgaataaactgggcatg
cttgccggggcacccgtgcgcattgtttctgtgggagcttctagagatcaaacttttttt
gtcgattaa

DBGET integrated database retrieval system