KEGG   Methylacidiphilum infernorum: Minf_0600Help
Entry
Minf_0600         CDS       T00727                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
min  Methylacidiphilum infernorum
Pathway
min00010  Glycolysis / Gluconeogenesis
min00260  Glycine, serine and threonine metabolism
min00680  Methane metabolism
min01100  Metabolic pathways
min01110  Biosynthesis of secondary metabolites
min01120  Microbial metabolism in diverse environments
min01130  Biosynthesis of antibiotics
min01200  Carbon metabolism
min01230  Biosynthesis of amino acids
Module
min_M00002  Glycolysis, core module involving three-carbon compounds
min_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Minf_0600 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Minf_0600 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Minf_0600 (gpmA)
Enzymes [BR:min01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Minf_0600 (gpmA)
Membrane trafficking [BR:min04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Minf_0600 (gpmA)
Exosome [BR:min04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Minf_0600 (gpmA)
  Exosomal proteins of melanoma cells
   Minf_0600 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACD82658
UniProt: B3DZZ7
Position
583082..583828
Genome map
AA seq 248 aa AA seqDB search
MKVVFLRHGESIWNRENRFTGWTDVDLSSRGIEEAENAARLLKEEGFEFDVAFCSVLKRA
IRTLWIVLDKMDRMWIPVEKSWRLNERHYGALQGLNKSEMAKKYGEEQVLLWRRSYDIVP
PRLENDDPRHPRFDPRYRSLPADELPAAESLKDTLERTVPYWKERIFPAILSGQKVLVSA
HGNSIRALIKYIENMSEKEIVGLNIPTGFPLVYDLDEQGNKLACYYLGDLEEIEKAQHRV
AAQGKASS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgtattcctccgtcatggtgaaagtatatggaatagagagaatcggtttacc
gggtggaccgatgtagacctgtccagccgcggcatcgaagaggctgaaaacgcggctagg
cttctcaaggaagaaggttttgaatttgacgtcgctttctgttccgtgttgaagcgggcg
atccgcaccttgtggatcgttctggacaagatggatcggatgtggattcccgttgaaaaa
agttggcggcttaatgaaaggcattacggtgccctccaggggttgaataaatcggaaatg
gccaaaaagtatggagaagaacaggttcttttgtggcggagaagctacgatattgttcct
ccaagactagagaacgatgatcccaggcatccccggtttgatcctcgctaccggtccttg
ccagccgacgagcttcccgcagcggaaagtttgaaggatacccttgagaggaccgttcca
tactggaaagaaaggattttccctgcgatcctctcaggccaaaaggtgctggtatccgcc
catgggaacagcatccgggcccttatcaagtacatagagaacatgagcgaaaaggagatc
gtcgggctgaatatccctaccggcttccccctggtttacgatttggatgagcagggcaac
aagcttgcttgctactaccttggagatttggaagagatagaaaaagcccagcacagagtg
gctgcccagggcaaggcctccagttga

DBGET integrated database retrieval system