KEGG   Methylacidiphilum infernorum: Minf_1003Help
Entry
Minf_1003         CDS       T00727                                 

Gene name
aceF
Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component or related enzyme
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
min  Methylacidiphilum infernorum
Pathway
min00010  Glycolysis / Gluconeogenesis
min00020  Citrate cycle (TCA cycle)
min00620  Pyruvate metabolism
min01100  Metabolic pathways
min01110  Biosynthesis of secondary metabolites
min01120  Microbial metabolism in diverse environments
min01130  Biosynthesis of antibiotics
min01200  Carbon metabolism
Module
min_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Minf_1003 (aceF)
   00020 Citrate cycle (TCA cycle)
    Minf_1003 (aceF)
   00620 Pyruvate metabolism
    Minf_1003 (aceF)
Enzymes [BR:min01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Minf_1003 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACD83058
UniProt: B3DUQ5
Position
complement(950017..951258)
Genome map
AA seq 413 aa AA seqDB search
MKQITMPLLSPSMTEGQIVRWLKKEGEPIQEGEVIAEVETDKAVMDLEAFESGILKQILL
PEGSRAPVNTPIALIETESEETGQLSTAHEPVMEAKEKSETPSLPKPSVQLKQGPVEEKP
QRIKSSPLARKIAGEEGIDLSAVQGTGPGGRIVKRDVLEKVEQKKKMLPVQEPGVISPRP
SPGVTKIPLSLMREKIAKRLLESKTTIPHFYLETEIVVTALSQLRNELNQYYSQHEQPWK
FTYNDFILKATIEAIKRVPAVNASWNGDSILHHDAIHLAFAVAIEDGLITPVIKDAQNKS
LMVLSKEAKELIQKAQERKLSPEEYSGGTITVSNLGMFGIESFYAIIDPPQDMILAIGSI
MKKPLVDGQNNIVIGEVMKVNASCDHRVIDGATGAKFLKEFKQIMENPLSMLV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagattacaatgcctttgttaagtccatcaatgacggaaggacagattgtcagg
tggttgaaaaaagaaggagaacctattcaagaaggagaagtgatcgctgaagtagaaacg
gataaggcggtaatggatctcgaggctttcgaatcgggtattttaaagcagattctactt
cccgaaggaagcagggcccctgtaaatactcccatcgccttaattgaaaccgaatccgag
gaaacagggcagctttcaactgcccatgaacctgtaatggaagccaaggaaaagtccgag
acaccgtctctacctaagccttcggtacagcttaaacaaggcccggttgaagaaaagccg
caaagaatcaagtcttctccactggctagaaaaattgccggcgaagaaggaattgacctt
tccgctgtccaaggaacaggtccgggaggacgcattgtgaaaagggatgtcttggaaaaa
gtagaacaaaagaaaaaaatgctcccggttcaagagcctggtgtcatttctccccgtcct
tctccaggagtgacaaaaatccccttgtctttaatgcgggaaaaaattgccaagcggctc
ttagaaagcaaaaccaccattccccatttttatcttgaaaccgaaatagtcgttactgca
ctctctcagctcagaaacgaactcaaccaatactattctcaacacgaacaaccgtggaaa
tttacctataatgatttcattttaaaagcaacgatagaggctataaaaagagtccccgcg
gtgaatgcttcatggaatggagactccatattacatcacgatgctattcaccttgctttt
gcggtcgctattgaagatggccttattactcccgtcataaaagatgctcaaaataaatcc
ttgatggttttatcgaaggaagccaaggagcttatccaaaaggctcaggaaagaaagtta
tcccctgaagagtattccggaggaacaattaccgtttccaatttaggaatgtttgggata
gaaagtttttatgccattattgatcccccccaagacatgatactggctataggatccatc
atgaaaaaacccctcgtcgatggtcaaaacaacatcgtcatcggagaagtgatgaaagtc
aacgcttcttgtgaccatagagtgattgacggtgcaacaggggcgaagtttttaaaagaa
tttaaacagatcatggagaatcccctttccatgctcgtataa

DBGET integrated database retrieval system