KEGG   Methylacidiphilum infernorum: Minf_1095Help
Entry
Minf_1095         CDS       T00727                                 

Gene name
hmp
Definition
(GenBank) Hemoglobin-like flavoprotein
Organism
min  Methylacidiphilum infernorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Globin Protoglobin
Motif
Other DBs
NCBI-ProteinID: ACD83150
UniProt: B3DUZ7
Structure
PDB: 

Position
1041100..1041501
Genome map
AA seq 133 aa AA seqDB search
MIDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEEPTVSVLFQNPISSQSRKLMQVLGI
LVQGIDNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAWT
KVYGIAAQVMTAE
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcagaaagaaaaagaactgattaaggaaagttggaaaaggattgaacccaat
aaaaacgaaatcggcttattattttatgccaacctgttcaaagaagaacctacagtttct
gtcctctttcaaaatcccatcagtagccaatcccgaaaactaatgcaggttcttggaatt
cttgtccagggcattgacaatctggaggggctgatccctacattacaagacttaggacgg
cgccataagcaatacggtgttgtcgattcccattatccgcttgtgggcgactgcctactt
aaatccattcaagagtacttgggccaaggttttaccgaagaagctaaggcggcttggact
aaggtctatgggattgccgcccaggtgatgacggcggaataa

DBGET integrated database retrieval system