KEGG   Methylacidiphilum infernorum: Minf_1117Help
Entry
Minf_1117         CDS       T00727                                 

Definition
(GenBank) Xanthosine triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
min  Methylacidiphilum infernorum
Pathway
min00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:min00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Minf_1117
Enzymes [BR:min01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Minf_1117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ACD83172
UniProt: B3DV19
Position
complement(1058925..1059533)
Genome map
AA seq 202 aa AA seqDB search
MIMQKILLATSNRHKYLEFSRLLYPLTLEALPEDLKRLLPNETAKSYRDNAKLKGMALSE
IYEGFVLADDSGLEVFSLHGEPGIFSSRYAGEGSSAQENIDKLLKNLQSKNITDRRARFV
CALVLVKKKKILFETTAFCYGIIADRQKGGGGFGYDPIFIPEGYSLTMAELDEKQKDLVS
HRGKACQELKAFFLENRMEGHS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgatcatgcaaaaaattctcttggccacctcgaatcggcataaataccttgaattttca
agacttctctaccctcttaccctggaagctttacccgaagatctaaaaagacttttgcct
aatgaaactgcaaagagttacagggataatgcaaagctgaaagggatggctttatccgaa
atttacgagggatttgttttagcggatgattcgggcttagaggtcttttcccttcatgga
gaacccggtattttttcaagccggtatgccggcgaaggcagcagtgcccaagaaaacata
gataaactgctcaaaaacctgcagagtaaaaatattacggaccgaagggctaggttcgtt
tgtgctcttgtcttggtcaagaagaaaaaaattctttttgaaaccaccgctttttgttat
ggcataatagcagatagacaaaaaggcggaggaggttttggttacgaccccatattcatt
cccgaaggttattctttaaccatggccgaactggatgaaaaacaaaaagatcttgtcagt
catagggggaaagcctgccaggaactgaaagccttttttctagaaaaccggatggaaggg
cattcatga

DBGET integrated database retrieval system