KEGG   Methylacidiphilum infernorum: Minf_2304Help
Entry
Minf_2304         CDS       T00727                                 

Gene name
purL
Definition
(GenBank) Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
min  Methylacidiphilum infernorum
Pathway
min00230  Purine metabolism
min01100  Metabolic pathways
min01110  Biosynthesis of secondary metabolites
min01130  Biosynthesis of antibiotics
Module
min_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:min00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Minf_2304 (purL)
Enzymes [BR:min01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     Minf_2304 (purL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_5 GATase_3 DJ-1_PfpI GATase Peptidase_C26 SNO
Motif
Other DBs
NCBI-ProteinID: ACD84358
UniProt: B3E0C9
Position
2140912..2141634
Genome map
AA seq 240 aa AA seqDB search
MGKKRTMNWAIVEFPGSNCGPDCLYVVEKVLKHKATLLWHTDKRIPPVDALILPGGFSYG
DYLRSGAIASLSPIMEAVKEAAQAGVPILGICNGFQILCESRLLPGALITNRSLRFVCKR
VYLRVERTDSLFSHLFHPGEVIRIPIAHGQGCFYADPQTLEQMEAQGMILLRYCDCQGQV
GPQSNPNGSVGNIAAVQNQRGNVLGLMPHPERAAETEMGSVDGKKIFESLFRAVEAYKGK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaaagaacaatgaattgggcgatcgttgaatttcccggttctaattgtgga
ccggactgtctttatgtcgttgaaaaggtactcaagcataaggccaccttgctttggcac
accgacaagaggatcccccccgtcgatgcccttatcctgccgggggggttttcttacggg
gactacttgagatcgggagccatcgcctcgctatcgcccatcatggaagcggtcaaagag
gctgcccaggccggcgtgcccattctaggaatatgcaacggctttcaaatcctttgtgaa
tctaggctccttcccggggccttgatcactaaccgctccttgcggtttgtttgcaagcgg
gtttatctccgggtggaaagaacggattccctcttcagccacctttttcatcccggggag
gttatccgcatccccatcgctcatggacaaggctgtttttatgccgatccccagaccctt
gagcagatggaagcccaggggatgatcctcttgcgctactgcgattgccaaggccaagtt
ggcccccagtccaatcccaacggttcggtgggaaacatcgccgcggtacagaaccagcgg
gggaatgtcctagggttgatgccccatcccgaaagagctgcggagaccgaaatgggatcg
gtcgacgggaaaaaaatctttgaatccctttttcgagccgttgaagcttacaaaggaaaa
tga

DBGET integrated database retrieval system