KEGG   Mesotoga infera: MESINF_2280
Entry
MESINF_2280       CDS       T05565                                 

Gene name
oraE
Definition
(GenBank) D-ornithine 4,5-aminomutase subunit beta
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
minf  Mesotoga infera
Pathway
minf00472  D-Arginine and D-ornithine metabolism
minf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:minf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    MESINF_2280 (oraE)
Enzymes [BR:minf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     MESINF_2280 (oraE)
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: SSC13720
Position
MESINF:complement(2387022..2389229)
AA seq 735 aa
MLLPNEKLRVEEILKDLEKYSPRRKGWAWRKQLPAGTRVDGFTYNQISEPLKNGIGLPAA
HYFENIDPQPDPVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHIDGLIEGTP
EGIGGIPITRKQLRATRKALDIIEDEVGRPINFHSYVSGVAGPEIAVLFAEEGVNGAHQD
PQYNVLYRGINPIRSFVDAAVAKKIMASVDMLQIDGAHNANASSKSAWKVMPELLVQHAI
NCAFSIRVGMKKDLIALSTVPPVTAPAPEFRLNFIYALTLRELFKEYRFRAQMNTRYIES
DLLDATRIHVLDTLISRLTKADIQSTITPDEGRNVPWHINSIRGIETAKHTLLALDGIKD
LVKVNEEAVRPQIREMKMRAILMMEEIIESGGYFEAVEQGFFVDNGQYPERNGDGIARMK
EGGIGAGTVVAREDDYYAPVCEHFGYNNIPEGLNRPDEPIGMCTLEDRSKIKYIDELDES
DNVNLRITTQLEDRKAGLIGPEVEWWSDGWVQLDLTIPDDLDHAEAAALEIARRMGLQEA
TVISKTVLHPVEGTYLELKARVPFKIERESLELPKKPDLLEPEEINGYLKEVPMKVVAGT
VGNDEHSVGIREILDIKHGGIEKYGFKYTYLGTSVNPEKFIDAAIETGADAILVSTIITH
NDVHIDNMKKISELSIEKGVRDKLILVSGGTQITNELAVECGMDAGFGRGTKGIHVASFL
VKKKREMRKADTGVS
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgctgttgccgaatgaaaaattgagagtcgaagagatcctgaaggaccttgaaaaatac
tctccgcgaagaaaaggctgggcatggcgaaagcaacttcctgctggcacacgagtcgat
ggcttcacctacaatcaaatcagcgaacctctgaaaaacggtataggactccctgcggca
cattatttcgaaaatatcgatccccagcccgatccggtgatcacctcggaaatcgcttca
ggacgcttcgaggacgacattcgaagaatgaggatggctgcctggcatggggctgatcac
ataatggttataagaacgctcggtcagagccacatagatggtttgatcgagggaacgccc
gagggaatcggaggcatcccgatcaccagaaaacagcttcgggcgacccgaaaggcactc
gatattatcgaagacgaagtgggccgtccgataaacttccactcttacgtcagcggtgtg
gccggtccagagatagccgttctcttcgccgaagagggagtcaacggtgcccaccaggac
ccccagtacaatgttctctacaggggaatcaaccccataagatcttttgtggacgcggcc
gtagcgaagaagatcatggccagtgtcgatatgctccaaatcgatggagcgcacaacgcg
aatgcctcttcaaagagtgcctggaaagtcatgccggaacttctagtccagcatgccata
aattgcgccttctcgatcagagtcggaatgaaaaaggatctgatcgccctctcaacggtg
ccgccagttacggctccggccccggaattcagactgaacttcatttatgcactgacgttg
agagaactctttaaagaatatcgtttcagagcccagatgaacacccgttacattgaatcg
gaccttctggacgcgacacgtatccatgttctggatacactgatatctcgtctgaccaaa
gccgatatacaatccacgataacccccgatgaaggcagaaacgtgccctggcacataaac
tcaataaggggtatagaaacagcgaaacatactcttctggccctggatggtataaaggac
ctcgtaaaggtaaatgaagaggctgtaagacctcagataagagaaatgaagatgcgagcc
atccttatgatggaggagataatagaatcgggaggctacttcgaagccgtagagcaaggc
ttcttcgttgacaacggacagtaccccgaacgaaatggagacgggatagccaggatgaaa
gaaggcggcatcggagccggtaccgtcgtggcaagagaggatgattattacgcgcccgtc
tgcgaacactttgggtataataacataccagagggcttgaatagacccgatgaaccgata
ggtatgtgtactctagaagataggagtaagatcaagtatatagatgagctagacgaaagt
gacaatgtgaatctgagaatcactacgcagcttgaggatagaaaggccgggctgatagga
ccggaagtggaatggtggagtgacggttgggtacagttagatctcacaataccagacgat
ctggatcatgcagaggccgcggctctggaaattgcaagaagaatgggtctgcaggaggct
actgtaataagcaagaccgttcttcacccggtcgaaggaacgtacctagaactgaaagcc
agagtgcctttcaaaattgaaagagaaagcctggaattgccaaaaaagcccgacctgttg
gagccagaagagataaacggctacctgaaagaggttcccatgaaagtggtagccggtacc
gtcggaaacgatgagcactcggttggcataagggagatactcgatatcaaacatggcggc
atagagaaatatggttttaaatacacatatctcggtacgagtgtgaatcctgagaagttt
atcgatgcggccattgagactggagccgacgccatactagtctccactataatcacccac
aacgatgttcacattgataatatgaagaagatttcggagctctcgatcgagaagggtgtt
agggacaaactcatactcgtctcgggaggtacgcaaataaccaatgaactggccgtagaa
tgcggcatggatgcaggctttggcagaggaaccaagggaatacatgttgcatctttcctg
gttaaaaaaaagagagagatgaggaaagcggatacaggtgtaagttaa

DBGET integrated database retrieval system