KEGG   Mesotoga infera: MESINF_2281
Entry
MESINF_2281       CDS       T05565                                 

Gene name
oraS
Definition
(GenBank) D-ornithine 4,5-aminomutase subunit alpha
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
minf  Mesotoga infera
Pathway
minf00472  D-Arginine and D-ornithine metabolism
minf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:minf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    MESINF_2281 (oraS)
Enzymes [BR:minf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     MESINF_2281 (oraS)
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: SSC13721
Position
MESINF:complement(2389213..2389599)
AA seq 128 aa
MAIQRPDDFDRRSEHLQRLNDEQLDRLFWELAGKIVDPLVELARTHTSPSIERSVLLRMG
MDSFQAGAIVSKALELGLLGKGAGHLVLRYSQYTGKSVEESAKELAQGRGWEELIEIFKR
RKENAVAE
NT seq 387 nt   +upstreamnt  +downstreamnt
atggcaatacagcgacctgatgatttcgaccggagaagtgaacatttacagcgtctaaac
gacgagcagctcgacagactgttctgggaactggccggaaagatagtcgatcctctcgtc
gaactcgcaagaacgcacacaagcccttcgatcgaacgttcggtactcctgagaatgggg
atggacagctttcaagccggggcgatcgtttcaaaagccttggaactgggtctgctagga
aaaggagctggtcacttggtattgagatactctcaatacactggtaaaagcgtagaagaa
tccgcgaaagaacttgcccaaggccggggctgggaagagcttatcgagattttcaagagg
aggaaggaaaatgctgttgccgaatga

DBGET integrated database retrieval system