KEGG   Mesotoga infera: MESINF_2587Help
Entry
MESINF_2587       CDS       T05565                                 

Definition
(GenBank) Haloacid dehalogenase domain protein hydrolase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
minf  Mesotoga infera
Pathway
minf00010  Glycolysis / Gluconeogenesis
minf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:minf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MESINF_2587
Enzymes [BR:minf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     MESINF_2587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: SSC14027
UniProt: A0A330PKW7
Position
MESINF:2717021..2717593
Genome map
AA seq 190 aa AA seqDB search
MRLFIFDVGGVVAANTSVVPQICDYLDIPQERFIELAGHESIKALQTGGMTEEDFALRLS
SKIGKEVPSNIWSIFFNPVPIEGTIKIIEKLKTRYRVVAGTNTIDPHYRIHKERNDYVLF
DEVYASHIMGLAKPDSEFYRHILYAENCTPEEAFFADDTLKNVLAARNLGIVSFHFTEPS
ALEERLKEYL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgagactctttatcttcgatgttggcggtgttgttgccgcaaataccagtgtggttccc
caaatatgcgattatctcgatattccccaggaaaggttcatagaactcgcaggccatgaa
agcatcaaggccctccaaacgggcgggatgaccgaagaggactttgcccttcgtctgtct
tcaaagataggtaaagaagtaccttccaatatctggtcgatcttctttaatcctgttccg
atcgaaggcacgatcaagatcatagaaaaattaaaaacccggtacagggtggtagccggg
acgaacacaattgacccccactacaggatacataaagaacgaaacgattatgtcttgttt
gacgaagtttacgcctcccacatcatgggtctggctaaacccgattcagagttttaccgt
catatcctttatgccgagaactgcacgcctgaggaggcttttttcgccgacgacactttg
aaaaatgttctggcagcgagaaatctgggtattgtatcatttcatttcacagaaccttcc
gctctggaagaaaggctcaaagagtatctttga

DBGET integrated database retrieval system