KEGG   Microbacterium sp. No. 7: AOA12_03385Help
Entry
AOA12_03385       CDS       T04102                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mio  Microbacterium sp. No. 7
Pathway
mio03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mio00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AOA12_03385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mio03011]
    AOA12_03385
Ribosome [BR:mio03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AOA12_03385
  Bacteria
    AOA12_03385
  Archaea
    AOA12_03385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALJ19000
UniProt: A0A0P0DQX5
Position
757193..757585
Genome map
AA seq 130 aa AA seqDB search
MVESIARVKHIRVTPQKARRVVALIKGKQAQEALAILKFAQQSASEPIGKLVASAIANAR
VKADKDGEYLDEQDLYVKNAYVDEGTTLKRFQPRAQGRAFQIKKRTSHITVVLATPELAE
AGAKNKKASK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggtggaatccatcgcacgcgtcaagcacatccgcgtgacccctcagaaggctcgtcgt
gtcgtcgcgctcatcaagggcaagcaggctcaggaggccctggccatcctgaagttcgct
cagcagagcgccagcgagccgatcggcaagctcgtcgcctcggcgatcgccaacgcgcgc
gtcaaggccgacaaggacggcgagtacctggacgagcaggacctgtacgtgaagaacgcg
tacgtcgacgagggcacgacgctcaagcgcttccagccccgcgcgcagggtcgtgcgttc
cagatcaagaagcgcacgagccacatcaccgtggtcctggccacgcccgagctggccgag
gccggcgccaagaacaagaaggcgagcaagtaa

DBGET integrated database retrieval system