KEGG   Microbacterium sp. No. 7: AOA12_04705Help
Entry
AOA12_04705       CDS       T04102                                 

Definition
(GenBank) hypothetical protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
mio  Microbacterium sp. No. 7
Pathway
mio00903  Limonene and pinene degradation
mio00930  Caprolactam degradation
mio01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mio00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AOA12_04705
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AOA12_04705
Enzymes [BR:mio01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     AOA12_04705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: ALJ19237
UniProt: A0A0P0DHM1
Position
complement(1055122..1056153)
Genome map
AA seq 343 aa AA seqDB search
MTSPTGTSPTETSPTETSSTGYTTYRASDGTTPVWPGPQTPPHADLVRVLEAMRRYALPD
SATMAERDAQLVAATANVTVPEGHEVRAVRLGGLDAEIVGTPAQLARPRRVLHLHGGGYV
LGSPATTRAVAAGLSLATDTAVASLDYRLAPAAPFPAALDDAVSAFRALADEAGDARLVA
ISGDSAGGGLALATAMRLRDTGGERPAAVIGLSPWLDLALAGGPADAAQRVDPQVTPTLL
ALFSDAYLGSADPHDPAASPLYGDLTGLPPVLAQAGTHEYLREDARRLLEAARAQGADVT
VDVFDGMIHVWHALAPRLAGARGALERVGAWLRDVAPAFRASA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcccaccgggacatctcccaccgagacgtctcccaccgagacgtcctccacc
gggtacacgacctatcgtgcgtccgacgggaccacgccggtctggcccgggccgcagacg
ccgccgcacgccgacctcgtccgcgttctcgaggcgatgcgccggtatgcgctgcccgac
tcggcgacgatggccgagcgcgacgcgcagctcgtcgccgcgacggcgaacgtgaccgtg
ccggaggggcacgaggtacgggccgtgcggctcggcgggctcgacgcggagatcgtcggc
acccccgcgcagctcgcccggccgcgacgcgtgctgcatctgcacggcggcggctacgtg
ctgggctcccccgcgacgacccgcgcggtcgcagccgggctgtcgctcgcgaccgacacg
gcggtcgcgagcctcgactaccggctggcccccgcggccccgttccccgcggcgctcgac
gacgcggtgtccgccttccgcgccctcgccgacgaggcgggagacgcgcgcctcgtcgcg
atctccggcgactccgcgggcggcggtctcgcgctcgcgaccgcgatgcgcctgcgcgac
acgggcggcgagcggccggcggccgtcatcggcctgtcgccgtggctggacctggcgctt
gccggcgggcccgccgacgcggcgcagcgcgtcgatccgcaggtcacgccgacgctgctc
gcgctgttctccgacgcctacctgggcagtgccgacccgcacgatccggcggcgtcgccg
ctgtacggcgacctcaccggtctgccgccggtgctcgcacaggcgggcacgcacgagtat
ctgcgcgaggatgcgcgacggctgctggaggccgcccgcgcgcagggcgccgacgtcacg
gtcgacgtcttcgacggcatgatccacgtgtggcatgcgctcgcgccgcgcctggccggc
gcgcgcggagcgctcgagcgcgtcggcgcatggctgcgcgacgtcgcgcccgccttccgc
gcctccgcctga

DBGET integrated database retrieval system