KEGG   Microbacterium sp. No. 7: AOA12_05260Help
Entry
AOA12_05260       CDS       T04102                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mio  Microbacterium sp. No. 7
Pathway
mio00051  Fructose and mannose metabolism
mio01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AOA12_05260
Enzymes [BR:mio01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AOA12_05260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Unstab_antitox
Motif
Other DBs
NCBI-ProteinID: ALJ19344
UniProt: A0A0P0E5K7
Position
complement(1178764..1179918)
Genome map
AA seq 384 aa AA seqDB search
MKAVHFGAGNIGRGFVGLLLHEGGYELVFSDVAAPLVDAINAASSYTVHEVGEGGTDKTV
TGFRAINSATDTQALIDEIATADVVTTAVGPTVLRFVAPHILAGLALRDPRRAPLQVMAC
ENAIGATDQLREEIVTLAGAAWDALSAHVVFANTAVDRIVPAQPAGAGVDVTVEPFYEWA
IERRPFGDAPPHIPGAHFVDDLAPYIERKLFTVNTGHAATAYFGAQEGAEKISDALADAG
VAARVARALEETSALLVAKHGLDPAELADYRATILRRFANPELPDTVGRVGRQPLRKLSR
HERFVGPAAEAAERGLAVDGLLAAIAAALRFDDPSDEQSAELQRRLRDEDAESLTASVTG
LEPGHPLFAAVAAAVAARRSELTA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtccacttcggggcaggcaacatcgggcgcggcttcgtcgggctgctgctg
cacgagggcggatacgagctcgtgttctccgacgtcgcggcgccgctcgtcgacgcgatc
aacgcggcgtcgtcgtacaccgtgcacgaggtcggcgagggcggcaccgacaagaccgtc
acgggattccgggcgatcaacagcgcgaccgacacgcaggcgctcatcgacgagatcgcc
acggccgacgtggtcacgaccgcggtcggccccaccgtgctgcgcttcgtcgccccgcac
atcctcgcggggctcgcgctgcgcgacccgcgccgcgcgccgctgcaggtcatggcgtgc
gagaacgcgatcggcgcgaccgaccagctgcgcgaggagatcgtgacgctggccggcgcc
gcgtgggacgcgctctcggcgcacgtcgtgttcgcgaacaccgccgtcgaccgcatcgtg
cccgcgcagcccgcgggcgcgggcgtcgacgtgacggtcgagccgttctacgagtgggcg
atcgagcggcggccgttcggcgacgccccgccgcacatcccgggcgcgcacttcgtcgac
gacctcgctccgtacatcgagcgcaagctgttcacggtcaacacggggcacgcggcgacg
gcgtacttcggggcgcaggagggcgccgagaagatctccgacgccctcgccgacgccggc
gtggcggcccgcgtcgcgcgggcgctggaggagacgtcggcgctgctcgtcgccaagcac
gggctcgaccccgcggagctcgccgactaccgcgccacgatcctgcggcgcttcgcgaac
ccggagctgcccgacacggtcggtcgggtcgggcggcagccgctgcgcaagctctcgcgg
cacgagcggttcgtcggtcccgccgcggaggccgccgagcggggcctcgccgtcgacggc
ctgctcgccgcgatcgccgccgcgctgcgcttcgacgacccgtccgacgagcagtcggcc
gagctgcagcgccgcctgcgcgacgaggacgccgagtcgctcaccgcctcggtgaccggc
ctggagcccgggcatcccctcttcgccgccgtcgccgccgccgtcgcggcccgccggtcg
gagctcaccgcctga

DBGET integrated database retrieval system