KEGG   Microbacterium sp. No. 7: AOA12_08305Help
Entry
AOA12_08305       CDS       T04102                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
mio  Microbacterium sp. No. 7
Pathway
mio00260  Glycine, serine and threonine metabolism
mio00630  Glyoxylate and dicarboxylate metabolism
mio00670  One carbon pool by folate
mio01100  Metabolic pathways
mio01110  Biosynthesis of secondary metabolites
mio01130  Biosynthesis of antibiotics
mio01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AOA12_08305
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOA12_08305
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AOA12_08305
Enzymes [BR:mio01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     AOA12_08305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: ALJ19907
UniProt: A0A0P0E5F5
Position
1794660..1795853
Genome map
AA seq 397 aa AA seqDB search
MTDSNDAGPGERSRFTPLRERHEALGASFTDFGGWQMPVRYTSDLAEHRAVREAAGIFDI
SHMAEFTIDGAEAAVFLDHALAGRLSNMAVGKAKYSLLLAEPRGIVDDVIVYRLAEDRFL
IISNAGNRDAVSEALRARTRSFAFGRTPELVGDDGSFGFVVGETGVRVEDVSDHYALLAV
QGPNAEAIVAATEGITEVSTPWSEQRYYAWADGLFQGTPLLIARTGYTGEDGFELLVAAD
RAPALWDAVVAAGAGHGLVPCGLAARDTLRLEAGMPLYGHELSLDVVPAQAGLGRVVAAD
KERFVGKEGIEPADGARVLVGLAASGRRAGRAGYAVTDADGAVVGEITSGALSPTLGHPI
AMAFVDPSAADGDLFLDVRGTRIPATVTDLPFYRRKK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagcaacgacgccggtcccggcgagcggtcccggttcacgcccctgagggag
cggcacgaggcgctcggcgcatcgttcaccgatttcggcggctggcagatgccggtgcgc
tacacgtccgacctcgccgagcaccgcgcggtgcgcgaggccgccggcatcttcgacatc
tcgcacatggcggagttcacgatcgacggcgcggaggccgcggtcttcctcgaccacgcc
ctcgcgggccgcctgtcgaacatggccgtcggcaaggcgaagtactcgctgctgctcgcc
gagccccgcggcatcgtcgacgacgtcatcgtgtaccgcctcgccgaggaccggttcctc
atcatctccaacgcgggcaaccgcgacgcggtgtccgaggcgctccgggcgcgcacccgt
tccttcgcgttcggccgcacccccgagctcgtcggcgacgacggatcgttcggcttcgtc
gtgggcgagaccggcgtgcgcgtcgaggacgtctccgaccactacgcgctgctcgccgtg
cagggcccgaacgccgaggcgatcgtcgccgcgaccgagggcatcaccgaggtctccacg
ccctggtccgagcagaggtactacgcctgggccgacggcctgttccaggggactccgctg
ctgatcgcccgcaccggctacacgggcgaagacggcttcgagctgctcgtcgccgccgac
cgcgcgcccgccctgtgggacgccgtcgtcgccgcgggcgccggccacggcctggtgccg
tgcggcctcgccgcccgtgacaccctgcgcctcgaggccgggatgccgctgtacggccac
gagctctcgctcgacgtcgtccccgcccaggccggcctcggccgggtcgtcgcggccgac
aaggagcgcttcgtcggcaaggagggcatcgagcccgccgacggcgcccgcgtgctcgtc
ggcctcgccgcctcgggccgccgcgcgggccgcgccggctacgcggtgacggatgccgac
ggcgccgtcgtcggcgagatcaccagcggcgcgctcagccccaccctcggccatccgatc
gcgatggccttcgtcgacccgtccgccgcggacggcgacctgttcctcgacgtgcgcggc
accaggatccccgcgaccgtcaccgacctgcctttctaccggaggaagaaatga

DBGET integrated database retrieval system